KEGG   Neisseria gonorrhoeae FA 1090: NGO0092Help
Entry
NGO0092           CDS       T00237                                 

Gene name
aroB
Definition
(RefSeq) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ngo01100  Metabolic pathways
ngo01110  Biosynthesis of secondary metabolites
ngo01130  Biosynthesis of antibiotics
ngo01230  Biosynthesis of amino acids
Module
ngo_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ngo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NGO0092 (aroB)
Enzymes [BR:ngo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     NGO0092 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-GeneID: 3282137
NCBI-ProteinID: YP_207265
UniProt: Q5FAD4
LinkDB All DBs
Position
complement(100459..101538)
Genome map
AA seq 359 aa AA seqDB search
MKTLTVHTPSHSYPIFIGNGLLPQAGSLLKPHLGKRAAIITNETVAPLYLGTLQTALDAA
GVSHFSIILPDGEAHKNWQTLNLIFDGLMQNRAERKTTLIALGGGVIGDMVGFAAATYQR
GAPFIQIPTTLLSQVDSSVGGKTAINHPLGKNMIGAFYQPQAVLADLDTLHTLPARELSA
GMAEVIKYGALGDIGFFEWLEQHMPELMALERAPLTQAVYRCCQMKADIVAQDETEQGIR
AWLNLGHTFGHAVEAEMGYGVWLHGEAVAAGCVLAARLSEQLGKTSAADTARLAALLEAA
GLPSAPPVFAFEKWLAHMSHDKKVSGGIMRFIGLNRLGEAVITEITDTDILRRTLQPYL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactgaccgtacacacgccttcgcacagctaccccatctttatcggcaacggg
ctgctgccgcaggcgggaagcctgctcaaaccgcatttgggcaaacgcgccgccatcatc
accaacgaaaccgtcgccccgctctacctcggcacgcttcagacggcattggatgcggca
ggcgtatcccatttcagcatcatcctgcccgacggcgaggcgcacaaaaactggcagacg
ctcaacctcatctttgacgggctgatgcaaaaccgcgccgaacgtaaaaccacgctgatt
gcgctgggcggcggcgtgatcggcgacatggtcggctttgccgccgccacctaccagcgc
ggcgcgccgttcatccaaataccgaccacgctgttgagtcaggtcgactcatcggtgggc
ggaaaaaccgccatcaaccacccgctcggcaaaaatatgatcggcgcgttttaccagccg
caggcggtgcttgcagatttggacacgctgcacaccctgcccgcccgcgaactgtccgcc
ggtatggcggaagtcatcaaatacggcgcgctcggcgacatcggcttttttgaatggctg
gaacagcatatgcccgaactgatggcactcgaacgcgcgcccctcacccaagccgtgtac
cgctgctgccaaatgaaggcagacatcgtcgcccaagacgaaaccgaacagggcatacgc
gcatggctcaacctcggacacaccttcggacacgccgtcgaagcggaaatgggttacggc
gtatggctgcacggcgaggccgttgccgccggctgcgtgttggcggcgcgtttgtccgaa
caactgggcaaaacctccgccgcagataccgcgcggctcgccgccctgctcgaagccgcc
ggactgccgtccgcaccgcccgtgtttgcctttgaaaaatggctggcacatatgagccac
gacaaaaaagtcagcggcggcatcatgcgctttatcggtctgaaccggctgggcgaagcc
gtcatcaccgaaattaccgacacggacatcctccggcgcaccctgcaaccgtatctctga

DBGET integrated database retrieval system