KEGG   Neisseria gonorrhoeae FA 1090: NGO0916Help
Entry
NGO0916           CDS       T00237                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00020  Citrate cycle (TCA cycle)
ngo00310  Lysine degradation
ngo00380  Tryptophan metabolism
ngo01100  Metabolic pathways
ngo01110  Biosynthesis of secondary metabolites
ngo01120  Microbial metabolism in diverse environments
ngo01130  Biosynthesis of antibiotics
ngo01200  Carbon metabolism
Module
ngo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ngo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ngo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NGO0916
  09105 Amino acid metabolism
   00310 Lysine degradation
    NGO0916
   00380 Tryptophan metabolism
    NGO0916
Enzymes [BR:ngo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NGO0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 NIL
Motif
Other DBs
NCBI-GeneID: 3281365
NCBI-ProteinID: YP_208024
UniProt: Q5F875
LinkDB All DBs
Position
complement(894872..896053)
Genome map
AA seq 393 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATVAAEAPAAAPAEAAPAAVPAAAQNNAAMPAAAKLAAETG
VDVNVLQGSGRDGRVLKEDVQNAAAKPAAAVAPAVALPAGARPEERVPMSRLRARVAERL
LASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVTALKKYPVV
NASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIA
IEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLAL
SYDHRIIDGREAVLTLVAIKDALEDPVRLLLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacactcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcccgtatcgatacagctgct
actgtcgctgctgaagcacctgcagccgctcctgccgaagctgccccggctgccgttcct
gctgctgcacaaaacaacgccgccatgcctgccgctgcaaaactggctgccgagaccggt
gttgacgtgaacgtattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgctgccaaacctgccgcagccgtggcccctgccgttgcacttcctgccggc
gcacgtcctgaagaacgcgtaccaatgagccgcctgcgtgcccgtgttgcagaacgcctc
ttggcttctcaacaagaaaacgccattctgactacattcaacgaagtcaacatgaaaccg
atcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacatggcgtaaaactg
ggctttatgtccttcttcgttaaagccgctgttacagccctgaaaaaatacccggttgtg
aatgcttctgttgacggcaaagacattgtgtaccacggctacttcgacatcggtatcgca
attggcagcccacgcggtttggttgtaccaatcctgcgcgatgccgaccaaatgagcatt
gccgacatcgaacaagcaattgttgattacgcaaaaaaagccaaagacggcaaaatcgct
atcgaagacctgaccggcggtacattcagtattaccaacggcggtactttcggttctatg
atgtccaccccgatcatcaacccgcctcaatctgcgattttgggtatgcatgccactaaa
gagcgcgctgtggttgaaaacggccaagttgttgtccgtccaatgatgtatctggctctg
tcttacgaccaccgtatcattgacggccgcgaagctgtattgaccttggtagccattaaa
gacgcgttggaagacccggtccgcctgttgttggatctgtaa

DBGET integrated database retrieval system