KEGG   Neisseria gonorrhoeae FA 1090: NGO0917Help
Entry
NGO0917           CDS       T00237                                 

Gene name
sucA
Definition
(RefSeq) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00020  Citrate cycle (TCA cycle)
ngo00310  Lysine degradation
ngo00380  Tryptophan metabolism
ngo01100  Metabolic pathways
ngo01110  Biosynthesis of secondary metabolites
ngo01120  Microbial metabolism in diverse environments
ngo01130  Biosynthesis of antibiotics
ngo01200  Carbon metabolism
Module
ngo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ngo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ngo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NGO0917 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    NGO0917 (sucA)
   00380 Tryptophan metabolism
    NGO0917 (sucA)
Enzymes [BR:ngo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NGO0917 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-GeneID: 3281399
NCBI-ProteinID: YP_208025
UniProt: Q5F874
LinkDB All DBs
Position
complement(896153..898981)
Genome map
AA seq 942 aa AA seqDB search
MMDEKLNFSYLFGSNAPYIEELYEAFLENPDAVDEKWKQYFTDLSKQPGTVAVDVAHTPI
RESFVTLAKKKIASAVAGGADEAMLKKQVSVLRLISAYRIQGVGAAQLDPLKRIPPRDIE
ALDPKFHGLSDADMALRFNMGEGDFANRGKLLLSQIISNLKQTYCGHIALEYIYIPNTEE
RRWVRNYFESVLSTPHYNADQKRRILKEMTAAETLERYLHTKYVGQKRFGVEGGESAIAG
LNYLIQNAGKDGVEEVIIGMAHRGRLNVLVNILGKKPGDLFAEFEGRAEIKLPSGDVKYH
MGFSSDIATPHGPMHVSLAFNPSHLEIVNPVVEGSARAKQKRLGENGRDKVLPVLIHGDS
AFIGLGVNQATFNLSKTRGYTTGGTVHIVINNQIGFTTSDIRDTRSTVHCTDIAKMVSAP
VIHVNGDDPERVCFAIQAALDYRKKFHKDIVIDVVCYRKWGHNEGDDPTLTQPMMYKKVS
QHPGARALYTEQLIAEGVVTQVEADGYIQAYRDALDKGEHVEQTTLSNFQRTQIDWSKYQ
GKDWREKIETGLPAADIERLTEKFTAVPEGFALHPTAKRVIEARKAMASGKQAIDWGMAE
TLAYASLLTKGHGVRISGEDSGRGTFSHRHAVLHDQKREKWDDGTYVPLRNMGEGLGEFL
VIDSILNEEAVMAFEYGFACSAPDKLTIWEAQFGDFANGAQVTIDQFLSSGETKWGRLCG
LTTILPHGYDGQGPEHSSARVERWLQLCSENNMQVIMPSEASQMFHLLQRQVLGSYRKPL
VIFMSKRLLRFKGAMSPLENFTEGSTFRPVIGDTAERASNDSVKRVVLCAGQVYYDLEAG
RAERKLEDDVAIVRVEQLYPFPYDEVKAELAKYPNAKSVVWAQEEPKNQGAFYQIRHRIE
DVISEEQKLSYAGRPSSASPAVGYSSKHIAQLKQLVEDALAL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgaaaaactcaatttctcttatctgttcggttcgaacgcaccctacattgag
gaattgtacgaggcttttttggaaaaccccgatgcggttgatgaaaaatggaagcagtat
ttcaccgatttgagcaaacagccggggacggttgctgtcgatgtcgcacacacaccgatt
cgcgaatcatttgttactttggcgaaaaagaaaattgcatctgccgttgcgggcggtgcg
gatgaggcaatgctgaaaaagcaagtcagcgttttacggctgatttctgcctatcgtatc
caaggcgtgggtgcggcccaacttgatccgctcaaacgtatccctccgcgcgatattgaa
gccctcgatccgaaattccacggtctgtcagatgccgatatggcgcttcgattcaatatg
ggcgagggtgattttgccaatcgcggcaaactgctcttgtcccaaatcatcagcaacctc
aaacaaacctactgcggccacatcgcattggaatatatctatattcccaataccgaagag
cgccgttgggtacgcaactattttgaaagcgtattgtccacaccgcattacaatgccgat
caaaaacgccgtatcttgaaagagatgaccgctgccgagactttggaacgttatctgcat
accaaatatgtcggtcagaaacgtttcggtgtcgaaggcggcgaaagcgcgattgccggt
ttgaactacctgattcaaaacgccggtaaggacggcgtggaagaagtcatcatcggtatg
gcgcaccgtggccgtctgaatgttttggtgaacattttgggcaaaaaacccggcgatttg
tttgccgaatttgaaggccgtgccgaaatcaaactgcctagtggcgacgtgaaataccat
atgggcttcagctccgatattgccacccctcacggcccgatgcacgtttctttggcgttc
aacccgtcacacttggaaatcgtcaatccggtagtggaaggttctgcacgcgccaaacaa
aaacgtttgggcgaaaacggccgcgataaagtcttgccggtattgattcacggcgattcc
gcatttatcggtttgggtgtcaaccaagcaacattcaacctgtctaaaacgcgcggttat
accacaggcggtacggtccatatcgtcatcaacaaccaaatcggctttaccacttccgat
atccgcgatacccgttcaaccgtacactgtaccgatatcgcaaaaatggtttccgctccg
gttatccatgtgaacggcgatgatcccgaacgcgtttgctttgccattcaagccgctttg
gattaccgcaaaaaattccataaagacatcgtaatcgacgttgtctgctaccgtaaatgg
ggtcacaacgagggcgatgatccgactttgacccaaccgatgatgtacaaaaaagtatcg
caacatccgggtgcgcgtgctttgtacaccgagcaactgattgccgaaggcgtggtaact
caagttgaggccgacggttacatccaagcctaccgtgatgctttggacaaaggcgaacat
gttgagcaaacaacgttgagcaacttccaacgcacacaaatcgactggagcaaataccaa
ggtaaagattggcgcgaaaaaatcgaaaccggtttgcctgccgccgacattgagcgtctt
actgagaaattcaccgctgtgccggaaggctttgccctgcatccgactgcaaaacgtgtg
atcgaagcgcgtaaagccatggcatccggcaaacaagccatcgactggggtatggccgaa
accctcgcatacgcaagcctgctgaccaaaggtcatggcgtgcgtatctccggtgaggac
tccggccgcggtacattctcacaccgtcatgccgttctgcacgatcaaaaacgcgaaaaa
tgggacgacggtacttatgttcctcttcgcaacatgggcgaaggcttgggcgagttcctg
gttatcgactctatcttgaacgaagaagccgtgatggcgttcgagtacggctttgcctgc
tccgctcctgacaagctgaccatttgggaagctcaattcggtgacttcgccaacggcgcg
caagtaactattgatcaattcctgtcttcaggcgaaaccaagtggggtcgcttgtgcggt
ctgaccaccatcctgccgcacggctacgacggtcaaggccctgaacactcttctgcacgc
gtagaacgttggttgcaactgtgttctgagaacaatatgcaagtcatcatgccgtctgaa
gcgtcgcaaatgttccatctcttgcaacgccaagtcttgggttcataccgcaaaccgctg
gtgattttcatgtccaaacgcctgttgcgcttcaaaggtgcaatgagcccgctggaaaac
ttcaccgaaggttcgactttccgtccggttattggtgataccgccgaacgcgcaagcaac
gacagcgtgaaacgcgtggtattgtgtgccggtcaggtttactatgacttggaagccggt
cgagccgaacgtaaactggaagatgatgtcgctatcgtccgcgttgagcagctgtatccg
ttcccatacgacgaggttaaagccgaactggcgaaatatccgaacgcaaaatctgtggtt
tgggcgcaagaagagccgaaaaaccaaggcgcgttctaccaaatccgccaccgcatcgaa
gacgttatcagcgaagagcaaaaactgtcttatgccggccgtccaagcagcgcatcgcct
gcagtgggctactcaagcaaacacattgctcaattgaaacaattggttgaagacgctttg
gcgttataa

DBGET integrated database retrieval system