KEGG   Neisseria gonorrhoeae FA 1090: NGO0920Help
Entry
NGO0920           CDS       T00237                                 

Gene name
sdhB
Definition
(RefSeq) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00020  Citrate cycle (TCA cycle)
ngo00190  Oxidative phosphorylation
ngo00650  Butanoate metabolism
ngo01100  Metabolic pathways
ngo01110  Biosynthesis of secondary metabolites
ngo01120  Microbial metabolism in diverse environments
ngo01130  Biosynthesis of antibiotics
ngo01200  Carbon metabolism
Module
ngo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ngo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ngo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ngo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NGO0920 (sdhB)
   00650 Butanoate metabolism
    NGO0920 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NGO0920 (sdhB)
Enzymes [BR:ngo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NGO0920 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     NGO0920 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_18 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 3281178
NCBI-ProteinID: YP_208028
LinkDB All DBs
Position
complement(900833..901561)
Genome map
AA seq 242 aa AA seqDB search
MRKGTLLMEKMSFEIYRYNPDVDAKPYMQRYELELEPTDVKLLDALVRLKAQDDTLSFRR
SCREGICGSDGMNINGKNGLACLTDLRSLKQPVKIRPLPGLPVIRDLIVDMTQFFKQYHS
VKPYVVNDNPIDADKERLQTQEERKELDGLYECILCACCSTACPSFWWNPDKFVGPSGLL
NAYRFIADSRDTITNERLDNLNDPYRLFRCHTIMNCVDVCPKHLNPTRAIGKIKEIMLKR
VV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaggaacacttctcatggaaaaaatgagttttgaaatttaccgttacaacccg
gacgttgatgccaagccttatatgcagcgttacgagttggaattggaaccgaccgacgtg
aaacttttggacgctttggtacgcctgaaagcacaagacgataccttgtctttccgccgc
tcctgccgcgaagggatttgcggatcggacggtatgaacatcaacggcaaaaacggcttg
gcgtgtctgaccgatttacgcagcttgaaacagcctgtcaaaatccgcccgctgcccggt
ctgcccgtcatccgcgacctgattgtggatatgacccagttcttcaaacaataccattcc
gtcaaaccttatgttgttaacgacaatccgattgatgcggacaaagagcgtctgcaaact
caggaagagcgcaaagagttggatggtttgtacgaatgtattttgtgcgcctgctgttcg
accgcctgtccgtcattctggtggaatcccgacaaattcgtcggtccgtccggcttgctg
aacgcctaccgcttcattgcggacagccgagataccatcactaatgagcgtttggataat
ttgaacgatccgtaccgtttgttccgctgccacaccattatgaactgcgtagacgtatgt
cctaaacacttgaatccgacccgagccatcggtaagattaaagagattatgttgaaacgg
gttgtttaa

DBGET integrated database retrieval system