KEGG   Neisseria gonorrhoeae FA 1090: NGO0921Help
Entry
NGO0921           CDS       T00237                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00020  Citrate cycle (TCA cycle)
ngo00190  Oxidative phosphorylation
ngo00650  Butanoate metabolism
ngo01100  Metabolic pathways
ngo01110  Biosynthesis of secondary metabolites
ngo01120  Microbial metabolism in diverse environments
ngo01130  Biosynthesis of antibiotics
ngo01200  Carbon metabolism
Module
ngo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ngo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ngo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ngo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NGO0921
   00650 Butanoate metabolism
    NGO0921
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NGO0921
Enzymes [BR:ngo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NGO0921
    1.3.5.4  fumarate reductase (quinol)
     NGO0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 GIDA Lycopene_cycl Pyr_redox_3 HI0933_like NAD_binding_8 NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 3281104
NCBI-ProteinID: YP_208029
UniProt: Q5F870
LinkDB All DBs
Position
complement(901660..903423)
Genome map
AA seq 587 aa AA seqDB search
MGFPVRKFDAVIVGGGGAGLRAALQLSKSGLNCAVLSKVFPTRSHTVAAQGGISASLGNV
QEDRWDWHMYDTVKGSDWLGDQDAIEFMCRAAPEAVIELEHMGMPFDRVESGKIYQRPFG
GHTAEHGKRAVERACAVADRTGHAMLHTLYQQNVRANTQFFVEWTAQDLIRDENGDVVGV
TAMEMETGEVYIFHAKAVMFATGGGGRIYASSTNAYMNTGDGLGICARAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILLNADGERFMERYAPTVKDLASRDVVSRAMAMEIYEG
RGCGKNKDHVLLKIDHIGAEKIMEKLPGIREISIQFAGIDPIKDPIPVVPTTHYMMGGIP
TNYHGEVVVPQGDEYEVPVKGLYAAGECACASVHGANRLGTNSLLDLVVFGKAAGDSMIK
FIKEQSDWKPLPANAGELTRQRIERLDSQTDGENVDALRRELQRSVQLHAGVFRTDEILS
KGVQEIMAIAERVKRTEIKDKSKVWNTARIEALELDNLIEVAKATLVSAEARKESRGAHA
SDDHPERDDENWMKHTLYHSDTNTLSYKPVHTKPLSVEYIKPAKRVY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcctgttcgcaagtttgatgccgtgattgtcggcggtggcggtgcaggttta
cgtgcagccctccaattatccaaatccggtttgaattgtgccgttttgtctaaagtgttc
ccgacccgctcgcataccgtagcggcgcagggcggtatttccgcctctctgggtaatgtg
caggaggaccgttgggactggcacatgtacgataccgtgaaaggttccgactggctgggc
gaccaagatgcgattgagtttatgtgtcgcgctgcgcctgaagcggtgattgagttggaa
cacatgggtatgccttttgaccgcgttgaaagcggcaaaatttatcagcgtcctttcggc
ggacatactgccgaacatggtaaacgtgcggtagaacgtgcatgtgcggttgccgaccgt
accggtcatgcgatgttgcatactttgtaccaacaaaacgtccgtgccaatacacaattc
tttgtggaatggacggcgcaagatttgattcgtgatgaaaacggcgatgtcgtcggcgta
accgccatggaaatggaaacgggcgaagtttatattttccacgccaaggccgtgatgttt
gctaccggtggcggcggtcgtatttatgcttcttctaccaatgcttatatgaataccggt
gacggtttgggcatttgcgcccgtgcgggcattccgttggaagatatggaattctggcaa
ttccacccgaccggcgtggcgggtgcgggcgtgttgattaccgaaggcgtacgcggcgag
ggcggtattctgttgaacgccgacggcgaacgctttatggaacgctatgcgccgaccgta
aaagacttggcttctcgcgacgtggtttcacgcgcgatggcgatggaaatctatgaaggt
cgcggctgtggtaaaaacaaagaccacgtcttactgaaaatcgaccatatcggtgcagaa
aaaattatggaaaaactgccgggcatccgcgagatttccattcagtttgccggtatcgat
ccgattaaagacccgattccggttgtgccgactacccactatatgatgggcggcattccg
accaattatcacggtgaagttgttgttccgcaaggcgacgagtacgaagtacctgtaaaa
ggcctgtatgccgcaggtgagtgcgcctgtgcttccgtacacggtgcgaaccgtttgggt
acgaactccctgctggacttggtggtgttcggcaaagctgccggtgacagcatgattaaa
ttcatcaaagagcaaagcgattggaaacctctgcctgctaatgccggtgagttgacccgc
caacgtatcgagcgtttggacagtcaaaccgatggtgaaaacgttgatgcattgcgtcgc
gaactgcaacgctccgtacaactgcacgccggcgtgttccgtaccgatgagattctgagc
aaaggcgttcaagaaatcatggcgattgccgagcgtgtgaaacgtaccgaaatcaaagac
aagagcaaagtgtggaataccgcgcgtatcgaagctttggaattggataacctgattgaa
gtggcgaaagcgactttggtgtctgccgaagcacgtaaagaatcacgcggtgcgcacgct
tcagacgaccatcctgagcgcgatgacgaaaattggatgaaacacaccctgtatcattcg
gacaccaataccttgtcttacaaaccggtacacaccaagcctttgagcgtggaatacatc
aaaccggccaaacgcgtttattga

DBGET integrated database retrieval system