KEGG   Neisseria gonorrhoeae FA 1090: NGO1510Help
Entry
NGO1510           CDS       T00237                                 

Definition
(RefSeq) bifunctional chorismate mutase/prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Pathway
ngo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ngo01100  Metabolic pathways
ngo01110  Biosynthesis of secondary metabolites
ngo01130  Biosynthesis of antibiotics
ngo01230  Biosynthesis of amino acids
Module
ngo_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
ngo_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:ngo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NGO1510
Enzymes [BR:ngo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     NGO1510
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     NGO1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT YjgF_endoribonc ACT_4
Motif
Other DBs
NCBI-GeneID: 3281542
NCBI-ProteinID: YP_208560
LinkDB All DBs
Position
complement(1477047..1478174)
Genome map
AA seq 375 aa AA seqDB search
MLECTANYRSGEIMSQTIDELLIPHRNAIDTIDAEILRLLNERAQHAHAIGELKGTGAVY
RPEREVAVLRRIQDLNKGPLPDESVARLFREVMSECLAVERPLTIAYLGPQGTFTQQAAI
KHFGHAAHTMACPTIDDCFKQVETRQADYLVAPVENSTEGSVGRTLDLLAVTALQACGEV
VLRIHHNLLRKNNGSTEGIAKVFSHAQALAQCNDWLGRRLPNAERIAVSSNAEAARLVAE
SDDGTVAAIAGRTAAEIYGLDMVAECIEDEPNNTTRFLVMGHHETGASGSDKTSLAVSAP
NRAGAVASLLQPLTESGISMTKFESRPSKSVLWEYLFFIDIEGHRRDAQIQTALERLGER
ASFVKAIGSYPTAVL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttagaatgcacggcaaattaccgttcaggcgaaattatgtcccaaactatcgacgaa
ctcctcatcccgcaccgcaacgccatcgacaccatcgatgccgaaattctgcgcctgctc
aacgaacgcgcgcaacatgcccacgccatcggcgagctgaaaggcacgggcgcggtgtac
cgccccgaacgcgaggttgccgtgttgcgccgcattcaggatttgaacaaaggcccgctg
cccgacgaatcggtagcacgcctgtttcgggaagtgatgagcgagtgcctcgccgtcgaa
cgtccgctgaccatcgcctatctggggccgcagggcacgtttacccaacaggcggcaatc
aagcatttcggacacgccgcgcatacaatggcgtgtccgaccatagacgactgcttcaaa
caggttgaaacccgtcaggcggattatctggtcgcgcccgtggaaaactcgaccgaaggc
tcggtcgggcgcacattggatttgcttgccgttaccgcgttgcaggcgtgcggcgaagtc
gttttgcgcatccaccacaacctgttgcgcaaaaacaacggcagcaccgagggtatcgcc
aaagtattttcgcacgcgcaggcgttggcgcagtgcaacgactggttgggcaggcgtctg
cccaatgccgaacggattgccgtgtccagcaatgccgaagccgcaaggctggttgccgaa
tcggacgacggtacggttgccgccatcgccggacgcacggcggcggaaatttacggactc
gatatggttgccgagtgcatcgaagacgaaccgaacaacaccacgcgctttctggtcatg
ggacatcacgaaaccggtgcaagcggcagcgacaaaacctcgctggccgtttccgcgccc
aaccgcgccggcgcggttgcctcgctgctgcaaccgctgaccgaatcgggtatttccatg
accaagtttgagagccgtccgagcaaatccgttttgtgggaatacctgttcttcatcgac
atcgaaggacaccgccgggacgcgcagattcagacggcattggaacgcttgggcgaacgc
gcttcgtttgtcaaagccatcggttcgtatccgactgccgttttgtag

DBGET integrated database retrieval system