KEGG   Neisseria gonorrhoeae FA 1090: NGO1713Help
Entry
NGO1713           CDS       T00237                                 

Definition
(RefSeq) hypothetical protein
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
ngo  Neisseria gonorrhoeae FA 1090
Brite
KEGG Orthology (KO) [BR:ngo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ngo03016]
    NGO1713
Enzymes [BR:ngo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     NGO1713
Transfer RNA biogenesis [BR:ngo03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    NGO1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-GeneID: 3281396
NCBI-ProteinID: YP_208746
LinkDB All DBs
Position
1670357..1672264
Genome map
AA seq 635 aa AA seqDB search
MSFHRKIRKMNIFYEESGQFKVAVVVQKNDATYQVDTQHGKRTKVKANNVFAEFDGDMAA
FLENAQAQAADIDTDLLWEVCGEEEFTAEAIAEEYYGHAPTKTELAATLIALYAAPVYFY
KKAKGVFKAAPEETLKQALAAIERKKQQDAQIDAWAEALKRGEMPSEIAADLRTILHAPD
KQSLTYKAFTKAADALKTSAYELAKKTGGITSIPQYLQDGFEIKYFPKGTGFPDLSLPEM
PDLPKADVTAFSIDDESTTEVDDALSLTDLGNGTKRVGIHIAAPSLAVRQGGGMEQIIMQ
RLSTVYFPGGKITMLPENWITAFSLDAGAYRPAVSIYFDVDGEFNVGEPTCKIEAVNIAA
NLRIQAIEPHFNAETGLDQAGEMMFAHHQDLIWFYQFATALQKARGKYEPDRAPQYDYSI
ELDEEGNVSVVRRERGSPIDTLVSEMMILANSTWAQMLDENGLPGLFRVQPAGKVRMSTQ
SEPHIGMGVQHYGWFTSPLRRAADYINQKQLLSLIDDTAEPLFQQSDAELFAALRDFDTA
YAAYADFQRQMEAYWSLVYLQQQGISELTATILKEDLVRIEGLPLTTRATGIPFDALPKS
QALFKITELDAEKQFVSLNYIKAAAPGGKTAGNAV
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttccacagaaaaatccgaaaaatgaatattttttacgaagagtccggccagttc
aaagttgccgtcgtcgtccaaaaaaacgacgctacctaccaagtcgatacccaacacggc
aaacgcaccaaagtgaaggcaaacaatgtctttgccgagtttgacggcgatatggcggcg
tttttggaaaacgctcaggcgcaggcggcggacatcgacaccgatttattgtgggaagta
tgcggcgaagaggagtttaccgccgaagccatcgccgaagaatattacggccatgcgccg
accaaaaccgagctggcggcgactttgattgcgctgtacgccgcgccggtgtatttctac
aaaaaagccaaaggcgtgttcaaagccgcgcccgaagaaactttgaaacaagcgcttgcc
gccatcgaacgcaaaaaacagcaagacgcgcaaatcgacgcttgggcggaagccttgaaa
cgcggcgagatgccgtctgaaatcgcggcggatttgagaaccatcttacacgcgcccgac
aaacagtcgctgacctacaaagcctttaccaaagccgccgacgcactgaaaacctccgcc
tacgaactggcgaaaaaaacgggcggcattacgtccattccgcaatacctgcaagacggc
tttgaaatcaaatacttccccaaaggaacaggtttccccgacctctcccttcccgaaatg
cccgacctgcccaaggccgacgttaccgccttttccattgacgacgaatcgaccaccgaa
gtggacgatgccttgagcctgaccgatttgggcaacggcacgaagcgcgtcggcatccac
atcgccgcgccgtcgcttgccgtccgacaaggcggcggaatggaacaaatcattatgcag
cggttgagtacggtttatttccccggcggcaaaatcacgatgctgcccgaaaactggatt
accgcgttcagcctcgatgcaggcgcataccgccctgccgtcagcatttatttcgatgtg
gacggcgagttcaacgtcggcgagccgacctgcaaaatcgaagccgtcaacatcgccgca
aacctgcgtatccaagccatcgagccgcatttcaacgcagaaaccggcttggaccaagca
ggcgaaatgatgttcgcccaccatcaagacctgatttggttctatcaattcgccaccgcc
ctgcaaaaagcgcgcggcaaatacgaacccgaccgcgcgccgcaatacgattacagcatc
gaattggatgaagaaggcaacgtctccgtcgtccgccgcgaacgcggttcgcccatcgat
acgctggtcagcgagatgatgattcttgccaacagcacttgggcgcaaatgctagacgaa
aacgggctgcccggccttttccgcgtccaaccggcaggcaaagtgcgcatgagcacccaa
tccgagccgcacatcggcatgggcgtgcagcattacggctggtttacctcgccgctgcgc
cgcgccgccgactacatcaaccaaaaacaactcctcagcctgatagacgacaccgccgag
ccgctcttccagcaaagcgatgccgaactcttcgccgccctgcgcgatttcgacaccgcc
tacgccgcctacgccgacttccaacggcagatggaagcctactggagcctcgtgtacctg
caacaacaaggcatcagcgaactgaccgcgacgattctgaaagaagacctcgtccgcatc
gaaggtctgccactgacaacgcgcgcgaccggtattccgtttgacgcgctgcccaaatcg
caggcattgtttaaaatcaccgaattggatgccgagaagcagtttgtctcgctcaactac
atcaaggcagccgcacccgggggcaaaacggcaggcaatgccgtctga

DBGET integrated database retrieval system