KEGG   Naegleria gruberi: NAEGRDRAFT_48232Help
Entry
NAEGRDRAFT_48232  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K10846  DNA excision repair protein ERCC-5
Organism
ngr  Naegleria gruberi
Pathway
ngr03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    NAEGRDRAFT_48232
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ngr03400]
    NAEGRDRAFT_48232
DNA repair and recombination proteins [BR:ngr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     NAEGRDRAFT_48232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_I XPG_N XPG_I_2
Motif
Other DBs
NCBI-GeneID: 8859114
NCBI-ProteinID: XP_002678672
JGI: Naegr1_48232
LinkDB All DBs
AA seq 985 aa AA seqDB search
MGVKGLWDLLRPAAFQVQSLDVLSGKTVAVDISVWLHQFMLGMGLEDHDDEFFFGRGANN
QTGQASFSQVRYLKALFKRICKLLYYDIKPIFIFDGATPLVKQKTIQKRRMRSTKHNFRL
KKVAKKLLNRRMLEKHSGVSSIDRKLINMKKAKEPESPKYEEDFDFAMPSSSSSSVASSS
GVASSSGVNSSNNQQTSVKDEEVSILCDERNYEGAMNDSFEAIERVDMNANLDLGSGVDP
EVFTQLPKEIQQDIIKQLRRSKRFKPDSHIRDLKKKTPEKFSTTQLDSFIKGSQASLQLK
KLLEVSERQHLLDSLPQNIGSSQSNDEITMVKEEPVEVEVEQESDEMGMGFFEEDEEPSI
FQSASQTTPKSNRASSSISSVEGDIGNFQIVAGGRLASNPNQGYVLLEKTPPKEKEQRET
PINTQKAELSKETIQRFSDFLSRKEVVEQEEILPAAKGKAPINVENEFDDEDDEIQITFS
NNDLDNISDSDMLPDSIFSTIVESGDSIRRNMNEEWETAQLVEEDEFEEVQGKSPPAVAG
GDTDEWDEVQAQPEEPIPIDIDEQVVIEDDFEPVQIDSSDDEVEEVTPSQSSVSITNESM
NSMDDSFENEQEALLKMSSVPLVSDEEARMQEMNAARFEQAMFDSDYPMIDLFNSKSKTT
NLFFALVDLAKDLLTYLGVPYLVSPSEADAQCGFLSKHNLVDAVITEDSDLFLFGANCVY
RNVFGSTRHIDKNIIEEYRMDNIFKVLGFTRTNLIQIALLLGSDYTDGVHNVGPVTATQV
VDAFNPEEKELDEDNLEEVTQGLKDFKLWVEDDTFNMGRTQKSWGKKGDFQFNYKGSKKK
FIFPEGFPDSKIIDAYTKPQVDDSLSDFVWADIDSDPSTQSSSSQVTASSSSTDPPKLNW
QGFYTFCLERMNMSREEVDSYIQPILTERKKRQAIRSKKVEEMTPLERFIFEADKKKKKA
AEIESKRVLNAIGSIKNKQAKKRKK
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtaaaagggttgtgggatttgttgcgtcctgcggcatttcaagtgcagagtctt
gatgtactctcgggaaagactgttgctgtggatattagtgtttggcttcatcaattcatg
ctcggaatgggattagaggatcatgatgatgaattcttctttggtcgaggagccaataat
caaacaggtcaagcatcgttttctcaagttagatatttgaaggctttatttaagagaatt
tgtaaattattatattatgacatcaaaccaatttttatatttgatggtgcaactccactt
gtaaaacagaaaacaattcaaaagagaagaatgagatcaaccaaacataattttcgattg
aaaaaagtggcgaaaaagttattgaatagaagaatgttggagaaacattcgggagtttct
tccatagatagaaaattgataaatatgaaaaaagctaaggaacctgagtcaccaaaatat
gaggaggattttgattttgcaatgccatcatcatcttcttcgtcggttgcatcaagtagt
ggtgttgcaagttcgagtggtgtaaatagttcaaacaatcaacaaacaagtgtaaaggat
gaagaagtttcaatattgtgtgatgagagaaattatgaaggagcaatgaatgattcattt
gaagctattgaaagagtggatatgaatgcaaatttggatttaggatctggagttgatcca
gaggtttttacacaactgccaaaggaaattcaacaggatattatcaaacaactgcgtaga
tctaagagattcaaacccgattcccatattagagatttgaagaaaaagactcctgaaaaa
ttctctactactcaacttgattcttttattaagggaagtcaagcatcattacaattgaag
aaattattggaagtttcagagagacaacatttattggattctctacctcagaatattgga
tcttcacaaagcaatgatgaaataacaatggttaaagaggagccagtggaagtagaagtg
gaacaagaatctgatgaaatgggtatgggattctttgaagaggatgaggagccatcaatt
ttccaatcagcttcacaaacaactccaaagtcgaatagagcctcttcatcgatttcctct
gtggaaggtgacattggaaactttcaaattgtagcaggtggtagactggcatcaaatcca
aatcaaggatatgtcctcctcgagaaaactccaccaaaagaaaaagaacaaagagagact
cctatcaatactcaaaaggcagagttaagtaaggaaacaattcaaagatttagcgacttt
ctctcaagaaaggaagttgtagagcaagaggaaatactacctgctgcaaaaggtaaagct
cctatcaatgtagaaaatgaatttgatgatgaagacgatgaaattcaaataacattttca
aataatgatcttgataatatttctgatagtgatatgctaccagattcaatattttcaaca
atagtggaaagtggggattctattagacgaaacatgaatgaagaatgggaaaccgctcaa
ttagtggaggaggatgaatttgaggaggttcaaggtaaatcaccaccagctgtggctgga
ggtgacacagatgagtgggatgaagtgcaggctcaaccagaagaaccaataccaatagat
attgatgaacaagtagtcattgaagatgattttgaacctgttcaaatcgacagcagcgat
gatgaagtggaagaagtcactccctcccaatcaagtgtatcaattacaaatgaatccatg
aactctatggatgattcatttgaaaatgaacaggaagcattattgaaaatgagttcggtt
cctctggttagcgatgaagaggcaagaatgcaagaaatgaatgcggctaggtttgagcag
gccatgttcgactctgattacccaatgatcgatctctttaactccaagtcgaaaacaaca
aatctcttcttcgccttggtggacctggccaaagatttattgacctatcttggtgttcct
tacttggtttcacctagcgaagccgatgctcaatgtggatttttatctaaacataattta
gtggatgctgtcattactgaggattctgacttgtttttgttcggtgcaaattgtgtatat
agaaatgtatttggatcgacaaggcatatcgacaagaatattattgaagaatatagaatg
gataatattttcaaagttttgggatttacaaggactaatctaattcagatagctctttta
ttgggctctgactatacggatggtgtacataatgttggtcctgtgacagcaactcaagtt
gtggacgccttcaaccctgaagaaaaagaactcgatgaagataatttagaagaagttacc
cagggattgaaggatttcaaattatgggttgaggacgacactttcaatatgggacgaact
caaaaatcatggggtaaaaagggtgatttccaattcaattacaagggttccaagaagaaa
ttcatcttcccagaaggattcccagatagtaagattattgatgcctacacgaaaccacaa
gtagatgattctctttcagattttgtttgggcagatattgatagtgatccatcaactcaa
tcctcatcgtctcaagttactgcttcttcttcttctactgacccaccaaaattgaattgg
caaggattttacactttctgtctagaacgaatgaatatgtcgagggaggaagttgattcg
tacattcaaccaattctaacagagagaaagaagaggcaagccatcagaagtaaaaaagta
gaagaaatgactcccctcgaacgattcatattcgaagcagacaagaaaaagaagaaggca
gctgaaattgagagtaaaagagttctcaatgcaattggatccattaagaataagcaagcc
aagaagagaaagaaataa

DBGET integrated database retrieval system