KEGG   Naegleria gruberi: NAEGRDRAFT_69293Help
Entry
NAEGRDRAFT_69293  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ngr  Naegleria gruberi
Pathway
ngr00730  Thiamine metabolism
ngr00790  Folate biosynthesis
ngr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NAEGRDRAFT_69293
   00790 Folate biosynthesis
    NAEGRDRAFT_69293
Enzymes [BR:ngr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NAEGRDRAFT_69293
Exosome [BR:ngr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NAEGRDRAFT_69293
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ngr00537]
 Enzymes
  NAEGRDRAFT_69293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 8862889
NCBI-ProteinID: XP_002675642
JGI: Naegr1_69293
LinkDB All DBs
AA seq 514 aa AA seqDB search
MYSDELDHSDHHHRDGSNSGMTSSPKRSFLIYWLIGSVTILVLSIILNIVLIGLQFKSGS
SVDTTQKPRNIIFMIGDGFGPAAQSFARYMMKNSASKITTLALDKYLVGSSKTYSSSSDV
TDSAAGATAFSCAQKTYNNAIGVDKNKKPCGTLLEAAIKKGMVTGLVATNPVTDATPAAF
SAHVDHRNKQDTIAFQQIKQLSDIFGTSTKKYGVDLLMGGGRAYFLPKESDGSQRKDSTD
VISTAKDLGYQYVENRNELSKIEKLPILGLFALEEMKYNIDRDDEEIEKEPTLTEMTKKA
LQLITKESTEKNRGFFLMVEGSRIDHCAHANDISCQWQEVTEYNEAFQYVMDYIKENPDT
LVVSTADHETGGVTINRDVDYVNQYIFYTEKIRAVTKSTEYIASKITNTTDFAQVASILN
TYGIPDLTMDEFNIMQTIRTPFLFAIDEVINRRARIGFTTRGHTAVDVNVYSYGPSSTLF
NGNQENTDIGQKIATLLGLDLNSITEQVNTYMNK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtacagtgacgagttagatcacagtgaccatcatcacagagatggatcgaattctggc
atgacctcctcaccaaagagaagtttcctcatctattggttgattggttctgtcacaatt
cttgtcttgtccataattttgaatattgttcttattggtctacaatttaaatcgggatca
tctgttgacactactcaaaaaccaaggaatattattttcatgattggagatggtttcggt
cctgctgcccaaagttttgctcgatacatgatgaagaattcagcatctaaaatcacaaca
cttgcattggacaagtatttggttgggtcttcaaaaacttactcatcctcctctgatgtc
actgatagtgctgctggagcaactgcattctcatgtgcacaaaagacctacaataatgca
attggagttgataagaataagaaaccatgtggaacattgttggaagctgctattaagaag
ggaatggttactggacttgtagctactaatcctgtgacagatgctactccagctgcattt
tctgcacacgttgatcatagaaacaaacaagataccattgccttccaacaaattaaacag
ttatctgacatttttggaacctctactaagaaatatggtgttgatttattgatgggaggt
ggcagagcatactttttaccaaaggaatcagatggaagtcaaagaaaagattcaacagac
gtcatttctacagccaaagatcttggatatcaatatgttgaaaatagaaatgaattgagc
aagattgaaaaattaccaattcttggattatttgctttggaagaaatgaaatataatatt
gatagagatgatgaagaaattgaaaaggaaccaactcttacagaaatgaccaagaaggca
ctccaacttattacaaaggaaagcactgaaaagaatcgtggtttcttcctcatggtcgaa
ggatcaagaattgaccattgtgcccatgccaatgatatttcctgtcagtggcaagaagtt
accgaatataatgaagcattccaatatgtaatggattatattaaggaaaatccagatacc
ttagttgtttcaactgctgatcatgaaactggaggtgtaacaattaatagagatgtcgat
tatgttaaccaatatattttctacactgaaaagattagagcagttaccaagtcaactgaa
tatattgcctctaaaattactaacactactgactttgctcaagttgcctcaattttgaat
acatatggtattccagatcttacaatggatgaatttaacattatgcaaacaattagaaca
ccattcttatttgccattgatgaagtcattaatagaagagctagaattggatttaccact
cgtggtcacactgcagtcgatgtgaatgtttacagttatggaccttcttcaactctcttc
aatggaaatcaagaaaatactgatatcggtcagaaaattgccaccctattaggcttagat
ttgaattccatcacagaacaagtcaacacctacatgaataaataa

DBGET integrated database retrieval system