KEGG   Naegleria gruberi: NAEGRDRAFT_74953Help
Entry
NAEGRDRAFT_74953  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ngr  Naegleria gruberi
Pathway
ngr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NAEGRDRAFT_74953
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ngr02000]
    NAEGRDRAFT_74953
Enzymes [BR:ngr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NAEGRDRAFT_74953
Transporters [BR:ngr02000]
 Other Transporters
  Pores ion channels [TC:1]
   NAEGRDRAFT_74953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 8857279
NCBI-ProteinID: XP_002670081
JGI: Naegr1_74953
LinkDB All DBs
AA seq 167 aa AA seqDB search
MPLSNHFHNTPVLSHFLVNVGLLNLRLFLIGRLSAIAKRREKTPATVEDLGVIMGGERQA
QLSKEQIDQINNPNSLVNRTLRIHRNDIENSLPFVSAAGVMVLLCLVQDASDEKTQWIAN
SLMYSYSIARFVYVYAYWNGKQPHRSISWILGFLTTAGILGFSYKLL
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcctttatcaaaccactttcacaacactccagttctttcacactttttggtaaacgtt
ggcttgttgaatcttcgtttgtttttgattggaagattgtcagcaatagccaaaagacgt
gagaaaactccagccacagttgaagatttaggagtgattatgggtggtgaaagacaagct
caattgagtaaggagcaaattgatcaaattaataatccgaacagtttagtgaatagaact
ttgagaattcacagaaatgatattgaaaatagtttgccatttgtgagtgctgctggtgtg
atggtcttgttgtgcttggttcaggatgcatctgatgagaaaactcaatggattgcgaat
agtttaatgtattcctattccattgctagattcgtgtatgtctatgcttattggaatggt
aaacaacctcatagatcaatttcttggatcttgggtttcttgacaactgctggaattttg
ggattttcttacaaattattgtaa

DBGET integrated database retrieval system