KEGG   Naegleria gruberi: NAEGRDRAFT_77247Help
Entry
NAEGRDRAFT_77247  CDS       T01241                                 

Definition
(RefSeq) alanine aminotransferase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
ngr  Naegleria gruberi
Pathway
ngr00220  Arginine biosynthesis
ngr00250  Alanine, aspartate and glutamate metabolism
ngr01100  Metabolic pathways
ngr01200  Carbon metabolism
ngr01210  2-Oxocarboxylic acid metabolism
ngr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NAEGRDRAFT_77247
   00220 Arginine biosynthesis
    NAEGRDRAFT_77247
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ngr01007]
    NAEGRDRAFT_77247
Enzymes [BR:ngr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NAEGRDRAFT_77247
Amino acid related enzymes [BR:ngr01007]
 Aminotransferase (transaminase)
  Class I
   NAEGRDRAFT_77247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 8852398
NCBI-ProteinID: XP_002681562
JGI: Naegr1_77247
LinkDB All DBs
AA seq 492 aa AA seqDB search
MQGIKKALSTSNINQNILKTSYAVRGKVVIRANQIEHELKTNPSKFPFQGIVYCNIGNPQ
QLKQKPLSFHRNVLSLLTASHLMGDSSKSSQLSQLFNADVLDRAQRIMSHIDAKSTGAYT
HSQGYEFVRDDVVEFIENRDGLAKGTIQTDRIFLTDGASPGVQLCLKMLIRNEKDGIMIP
IPQYPLYSATIDLCGGSQVPYYLEEEKGWGLGMPELERAYEQAIKNGQNVRALVIINPGN
PTGQVLERKDMEQIIQFCVNKGVVLLADEVYQENNYTNGKKPFYSFNKIAYEMGLQKELE
MVSFHSVSKGFIGECGRRGGYFQLSEAIDPAVKEELYKISSVNLCPNADGQIMVDLMVRP
PSQGEASYQEYVAERDNILNSLKRRAEKLVKMLNSLEGVSCQPVEGAMYAFPQITLPEKA
IQKAKEMGVAPDLMYVLELLEETGICVVPGSGFQQKPGTYHFRTTILPSEEQIEGVVQTL
AKFHDKFMKQYK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtattaagaaagccctctctacctcaaatatcaatcaaaacattttgaagact
tcctatgctgtccgtggtaaggtcgtcattcgtgctaatcaaattgaacacgaattaaag
acaaatccatccaaattcccattccaaggaattgtctactgcaacattggtaatccacaa
caattgaagcaaaagccattgtctttccatcgtaatgttctctcattgttgactgcttct
cacttgatgggtgattcttccaagtcaagccaattgtctcaattgttcaatgctgatgtt
ttggatagagctcaaagaattatgagccacattgatgccaagtcaactggtgcttatact
cactctcaaggttacgaatttgttcgtgatgatgttgttgaattcattgaaaatagagat
ggacttgctaagggaaccattcaaactgatagaatcttcttgactgatggtgcttctcca
ggtgttcaattgtgcttgaagatgctcattagaaatgaaaaggacggtatcatgattcca
attccacaatatccactctactctgccactattgatttgtgtggtggttctcaagttcca
tactatcttgaagaagaaaaaggatggggtttgggtatgccagaattggaaagagcttat
gaacaagctattaagaatggtcaaaatgttcgtgctttggtcattattaacccaggtaat
ccaactggtcaagttttggaaagaaaggatatggaacaaattattcaattctgtgtcaat
aagggagttgtcttgttggctgatgaagtttatcaagaaaataactacactaatggtaag
aagccattctactcattcaacaagattgcctatgaaatgggacttcaaaaggaattggaa
atggtcagtttccacagtgtttctaagggtttcattggtgaatgtggtagaagaggtggt
tacttccaattgagtgaagctattgatccagctgttaaggaagaattgtacaagattagt
agtgtcaatctctgtccaaatgctgatggtcaaattatggttgatttgatggttcgtcca
ccatctcaaggtgaagcctcataccaagaatatgttgctgaaagagacaatattttgaat
agcttgaagagaagagctgaaaagttggtcaagatgttgaacagtttggaaggtgttagt
tgccaaccagttgaaggtgccatgtatgctttcccacaaattactctcccagaaaaggcc
attcaaaaggctaaggaaatgggtgttgctccagatttgatgtacgttttggaattgttg
gaagaaactggtatctgtgtcgttccaggttctggtttccaacaaaagccaggtacttat
cactttagaactaccattttaccaagcgaagaacaaattgaaggtgttgtccaaactttg
gccaaattccacgacaagttcatgaagcaatacaagtaa

DBGET integrated database retrieval system