KEGG   Naegleria gruberi: NAEGRDRAFT_77359
Entry
NAEGRDRAFT_77359  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
ngr  Naegleria gruberi
Pathway
ngr00620  Pyruvate metabolism
ngr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NAEGRDRAFT_77359
Enzymes [BR:ngr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     NAEGRDRAFT_77359
SSDB
Motif
Pfam: Archaeal_AmoA
Other DBs
NCBI-GeneID: 8850375
NCBI-ProteinID: XP_002677896
JGI: Naegr1_77359
LinkDB
AA seq 1165 aa
MTTHCSFFEGKELSDSIGYYTDLEKWNEDQTTLKQYVNLKLSASGLPLFGKLDKLLQITD
PLLNTFKEHDRLLDNYQCPIDKRIQSFINSYVSDLQGYDVNSLHLPANCLELDRVGMARL
LSLPGDGDKFENDIVCSYRLKQGVLHNPVNDRRTTQGSFHIALGGLPVPADKMEVPKLVW
ANLLKEALNPPSSNKTLPYTSNQCEEKKAKCWVSLMLRPLLSPAVPGESEEKTMEVRFFA
PGSLVSNLDFVESIFGNAGHAYYTENDAALDVRRWSGHTGCVILAPHLTKVTKKSLGLPH
ISTATDRQKRDGMCYEKDTDLYNMGEAFKITCRTNTGVILTIIADNYFGYCKKEVKSQMT
YATNLYGNCEEEHSGGAIAFPSYYLGDTFRLKDYHIDEEYTFKEMTTRCNGRISVDESLG
MGIDNRFSDILYLPEDAFFTLHGQNISWSHYKTGEKVNIRLKPNITYILPSGYRVEMIHE
KSGFSLIGTVGTGTYCHKPSTISGGGKSEISKSIGDAIITGPVIVADFMKDLETVEQLIE
KDYSKRFQDKTVTDTRAVLSMERSLGSVVKLLTCSESYTEEYNQWLLSIPSYIKQLVFIV
KSLYKPSWEGKWKEKFSVDLVNGSFGNSLKYKMEPVVGHYMRVGFQNNSWRTFELRKDFT
PAFKIQTEDDMTSSVVVPIRKLQSKYLQNSRVKGTSIKISKNTEFRLFQRPDDCIIRGYD
KKCESDLATPNTFICNFEALDQKGVQDILDDTISFHAYTKPQRQFLEEYAKEGVPSYCVA
SSNTRVVGPNQRSKNPRYLQNSEELTKPRKYYLAEVCTRLHQVLSPTTAVVYPVDAVISG
RRNNPEMKGVPPLCVHNPIHYLELPELFMEYISSMTGKSPSTTGACGSEGALTKGPFCPI
LSITELNTALVSMILTGSDGYFSSAGTLGPNYRVDHDVSLLIPEIWCRMKAEERDPSYLI
KNDMLEKLNDFEHNGQLVQASRLGYRITKKFVRTFFGRLFTNPSSVFTDDMLQPEKQGVD
TFVKSLGIILDTYKSVALSYFEDGSIDGACPPLKAVLHVMAHGHYNGKSINDSEIRQMFT
EQALLSSEWYKERLATRQKVLINCLNRSKEYLTNFSHQPRYSDLAEKLNINEKLSYVESE
LVKVSDVKYLEDLVGHLGTDPFMYK
NT seq 3498 nt   +upstreamnt  +downstreamnt
atgactacacattgttcctttttcgaaggcaaggaattgtctgactctatcggttattac
actgatcttgaaaagtggaacgaagatcaaaccactctcaagcaatatgtcaacttgaaa
ctctctgcatcaggtcttccactctttggaaagcttgataagcttcttcaaatcaccgat
cctctcttaaatacattcaaggaacatgatagattattggataattatcaatgtccaatc
gacaaacgtattcaaagctttatcaattcttatgtgtctgatttgcaaggttatgatgtt
aattctcttcatcttcctgcaaattgtttggaattagatagagtgggtatggcaagactc
ctctccttaccaggtgatggtgataaattcgaaaatgatattgtttgttcatacagatta
aaacaaggtgtattacacaatccagtcaatgacagaagaaccacacaaggttctttccat
attgctttgggaggcttaccagttcctgctgataagatggaagttccaaagcttgtttgg
gccaatctcttgaaagaagccctcaatccaccttcttcaaataagactttaccatatact
agtaatcaatgtgaggaaaagaaagccaaatgttgggtttcactcatgttacgtcctctt
ttaagtcctgctgttccaggagaatcagaagaaaagactatggaagttagattctttgct
cctggttctttagtttcaaatcttgattttgttgaaagtattttcggaaatgctggacat
gcttattacactgaaaacgatgctgctttggatgtcagacgttggtctggtcacactggt
tgtgttattttggctcctcacttgactaaggtaactaaaaaatcacttggtctccctcac
atcagtactgcaactgatagacaaaagagagatggaatgtgttatgaaaaggatactgat
ttgtataatatgggtgaagctttcaagattacttgtagaacaaataccggagttattctt
acaatcattgctgataactatttcggatattgtaaaaaggaagtcaagtcacaaatgacc
tatgctactaatttgtatggtaactgcgaagaagagcatagtggtggtgctattgcattc
ccttcatattatttgggagatactttcagattgaaagattaccatattgatgaggaatat
actttcaaggaaatgacaacaagatgcaatggaagaatttctgttgatgaatctctcggc
atgggtatcgataatagattctctgatatcctataccttccagaagatgcattctttact
ttgcacggtcaaaacatttcttggtctcactacaagactggtgaaaaggtcaacattaga
ttgaagccaaatattacttatattcttccatctggttatagagttgaaatgattcacgaa
aagtcaggattctctcttattggtactgttggtactggtacttactgtcacaaaccaagt
actatttctggaggtggtaaaagtgaaatttccaagtcaattggtgatgcaatcattact
ggtccagtaattgttgctgattttatgaaggatttggaaactgtcgaacaattaattgaa
aaggattatagtaagagattccaagacaagactgttactgatactcgtgctgttttaagc
atggaaagatcacttggtagtgttgtcaaacttctcacctgttctgaatcttacactgaa
gaatataatcaatggttgctttcaatcccatcctacatcaaacaattggtctttattgtc
aagagtttgtacaaaccatcttgggaaggcaagtggaaggagaaattcagtgttgacttg
gttaatggttcctttggtaacagcttgaaatacaagatggaaccagttgttggccattat
atgcgtgttggtttccaaaacaactcttggagaactttcgaattgagaaaggactttact
ccagctttcaagatccaaaccgaagacgatatgacctcctctgttgtcgttcctataaga
aagctccaaagcaagtacctccaaaacagtcgtgttaaaggtacctcaatcaagatctca
aagaataccgaattcagattgttccaaagaccagatgattgtatcattagaggttatgat
aagaagtgtgaatctgacttggctactccaaatactttcatttgtaactttgaagctttg
gatcaaaagggtgttcaagatattctcgatgatactatcagtttccatgcttacactaag
ccacaacgtcaattcttggaagaatacgcaaaggaaggtgttccaagctattgtgttgct
tcatcaaataccagagttgttggaccaaatcaaagatcaaagaatccaagatacttgcaa
aacagtgaagaattgaccaagccaagaaagtactatttggctgaagtctgcactcgtttg
caccaagttctctcacctacaactgctgttgtctatccagttgatgctgttatttctggt
cgtagaaataaccctgaaatgaagggtgtccctccactctgtgtacataacccaatccac
tatttggaacttcctgaacttttcatggaatatatcagttccatgactggtaaatcacca
tctactactggtgcttgtggttctgaaggtgctcttactaagggtccattttgtccaatt
ctctctattactgaattgaacacagcccttgtctcaatgatcttgactggttcagatggt
tacttctctagtgctggtactttgggtccaaattaccgtgttgaccacgacgtttctctc
ttgattccagaaatttggtgtagaatgaaggcagaagaacgtgatccaagctacctcatc
aagaatgacatgctcgaaaagctcaatgactttgaacacaatggtcaacttgttcaagca
agtagacttggttatcgtatcactaagaaattcgttagaacattctttggtagattattc
accaatcctagctcagtctttactgatgatatgctccaacctgaaaagcaaggtgttgat
acatttgtgaaatctcttggtattattttggatacatacaagtcagttgccttgtcttac
tttgaagatggttctattgatggtgcttgtccaccacttaaggctgtactccacgttatg
gctcacggtcactacaatggaaagagcattaatgactcagaaattcgtcaaatgtttact
gaacaagctctcttgtcaagtgagtggtataaggaaagacttgcaacccgtcaaaaggtt
ctcattaattgtttgaacagaagtaaggaatatcttacaaacttttcccatcaacctcgt
tacagtgatttggctgaaaagttgaacattaacgaaaaattgtcctatgtcgaaagtgaa
cttgttaaggtttctgatgttaaatatttggaagatttggttggtcatttaggtacagat
ccattcatgtataaataa

DBGET integrated database retrieval system