KEGG   Naegleria gruberi: NAEGRDRAFT_83231Help
Entry
NAEGRDRAFT_83231  CDS       T01241                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ngr  Naegleria gruberi
Pathway
ngr00020  Citrate cycle (TCA cycle)
ngr00190  Oxidative phosphorylation
ngr01100  Metabolic pathways
ngr01110  Biosynthesis of secondary metabolites
ngr01130  Biosynthesis of antibiotics
ngr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NAEGRDRAFT_83231
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NAEGRDRAFT_83231
Enzymes [BR:ngr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NAEGRDRAFT_83231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 NAD_binding_8 GIDA HI0933_like DAO FAD_binding_3 Thi4 Lycopene_cycl ApbA Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 8851581
NCBI-ProteinID: XP_002674784
JGI: Naegr1_83231
LinkDB All DBs
AA seq 678 aa AA seqDB search
MLKSCRKLKGVSALKSSIQQQLKNNSVFSSSSSLINSTTKTSTTTSNTKRCFSSNTKNLV
VLGNSAVRQGTMTDKGPQLSQVYPVIDHTYDAVVVGAGGAGLVCAANLAKAGYKVACISK
LFPTRSHTVAAQGGINAALGNMTEDHWTYHAYDTVKGSDWLGDQDAIHYMCKEAPQAVIE
MEHMGLPFSRTPEGKIYQRAFGGQSIKFGKGGQARRCCAAADRTGHALLHTNYGMALKYD
VQFFIEYFALDLLMEGDECRGVMTYCLEDSSMHRFRSHYTILATGGYGRAYGSCTSAHTC
TGDGTAMVSRAGLPNQDLEFVQFHPTGIYGAGCLITEGARGEGGFLRNSEGERFMEKYAP
SVKDLASRDVVSRAMTMEILEGRGCGPKKDHIHLHLDHLPTDLLHERLPGITETAKIFAG
VDLTKEPIPVVPTVHYNMGGVPTLYTGQVVYKKSEDQPDYPVKGLLAAGEVACASVHGAN
RLGANSLLDLVVFGRACALYVMENLPKDTKHKPLPSDAGMQSIVRLDKLFNSDKGTIKCH
ELRKEMQSVMQNYAAVYRKQETLETGCKLIKEAYDKLPYLKLGDKSPIYNVNLYEILELQ
NLLINAVQTMLSAENRKESRGAHARDDFPDRDDATWMKHTLTTMDVDTGKVNIEYRPVHS
YTLDEKEWGYIPPFKRVY
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtcttgcagaaagttgaagggagtctctgctttgaagtcttcaatccaacaa
caattaaaaaacaactctgttttttcatcttcatcatcattaattaattctactactaaa
acatccacaacaacatccaatactaaaagatgtttttcatctaataccaaaaatttggtt
gtgctaggaaatagtgctgttagacaaggaacaatgaccgataagggaccacaactctca
caagtttatccagtaattgaccatacttatgatgctgttgttgtaggtgctggtggtgct
ggtctcgtttgtgctgccaacttggccaaagctggatacaaggttgcctgtatttccaag
ttgttcccaacaagatcacacactgttgctgctcaaggtggtattaacgctgctcttgga
aatatgacagaagatcactggacttatcacgcctatgatacagtcaagggtagcgattgg
ttgggtgatcaagatgctattcactacatgtgtaaagaagctccacaagccgttattgaa
atggaacatatgggtcttcctttctctcgtactcctgaaggtaaaatttatcaaagagct
ttcggtggtcaaagtatcaagtttggtaaaggtggtcaagctagaagatgttgtgctgct
gctgatagaacaggtcacgctcttctccacacaaactatggtatggctttgaaatatgac
gtccaattctttattgaatatttcgctttggacttgttgatggaaggagatgaatgtaga
ggtgttatgacttattgtcttgaagatagtagtatgcatcgtttccgttctcactacact
attttggctacaggaggttatggtagagcttatggttcatgtacttctgctcacacttgt
actggtgacggtactgccatggtttctagagctggtttaccaaatcaagatttggaattt
gttcaattccaccctactggtatctatggtgctggttgtttaattacagaaggcgctcgt
ggtgaaggtggtttcttgagaaatagtgaaggtgaacgttttatggaaaagtatgctcct
agtgtcaaggatttggcttcaagagacgttgtcagtagagctatgactatggaaattttg
gaaggtagaggatgcggtccaaagaaggatcacattcacttgcacttggatcacttgcca
actgatttacttcacgaaagattaccaggtattactgaaactgccaagattttcgctggt
gtcgatttgactaaggaaccaattccagtcgttccaactgttcactacaatatgggtggt
gttccaactctttacactggtcaagttgtctataagaagtctgaagatcaaccagattat
ccagttaagggtttgttggctgctggtgaagttgcttgtgcttctgttcacggtgctaat
cgtttgggtgctaactcacttttggatcttgtcgtctttggtcgtgcttgtgctttgtac
gtcatggaaaatttgccaaaggatactaagcataagcctcttccatctgatgctggtatg
caatcaattgttcgtttggataagcttttcaatagtgataagggaactatcaaatgtcac
gaattgagaaaggaaatgcaaagtgtcatgcaaaactatgctgctgtctatcgtaagcaa
gaaactttggaaactggttgtaaactcattaaggaagcttatgataagctcccatacctt
aagttgggcgataagtcaccaatttacaatgttaacctttatgaaattctcgaattacaa
aaccttttgatcaatgctgtacaaactatgctttcagctgaaaacagaaaggaatccaga
ggtgctcacgctcgtgacgacttcccagacagagatgatgctacatggatgaagcacact
cttaccacaatggatgttgatactggtaaggtcaatattgaatatagaccagtccacagt
tatactctcgatgaaaaggagtggggatatattccaccattcaagcgtgtctattaa

DBGET integrated database retrieval system