KEGG   Nocardiopsis gilva: CDO52_02190
Entry
CDO52_02190       CDS       T05022                                 

Definition
(GenBank) SDR family oxidoreductase
  KO
K12703  novobiocin biosynthesis protein NovJ
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00401  Novobiocin biosynthesis
ngv01100  Metabolic pathways
ngv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CDO52_02190
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase OMPdecase 2-Hacid_dh_C 3HCDH_N
Other DBs
NCBI-ProteinID: ASU81754
UniProt: A0A223S0W8
LinkDB
Position
423496..424284
AA seq 262 aa
MTSTADTAAASAVAHQPVAMVTGAGRGIGAATAERLASEGMAVIVVDRAEEDTTATVSAI
RAAGGRASGRGCDVAEAHAVTATVASVIEEFGHLDVLVNSAGVNEDRLLLTMGDREWDTV
LDVNLGGTMRCSFAVGRHMRWQGHGRIINFSSVAARGNAGQTNYATAKGAIAGFTRTLAA
ELGPHGVTVNAIAPGFVATPMVDELTERLGVDRETFLQEAAMSSAVGRIGTPEEVAATVA
FLTHPESGYLTGETIHVEGGRR
NT seq 789 nt   +upstreamnt  +downstreamnt
atgacgagcactgccgacacggccgccgcatccgcagtggctcaccagccggtcgccatg
gtcacgggcgccggccggggcatcggcgcggccacggccgagcgccttgcctcggagggc
atggcggtgatcgtggtggaccgcgccgaagaggacaccaccgccacggtctcggccatc
cgcgcggccggcggacgggccagcgggcgcggctgtgacgtcgccgaagctcacgcggtg
acggccacggtcgcctcggtcatcgaggagttcggccacctcgacgtactggtgaacagc
gcgggggtcaacgaggaccggctgctgctcaccatgggcgaccgggagtgggacacggtc
ctggacgtcaacctcggcggcaccatgcgatgttcgttcgcggttggcaggcacatgcgc
tggcaggggcacggccggatcatcaacttcagttccgtggccgcgcgcggcaatgctggc
cagaccaactacgcgaccgcgaagggcgcgatcgccgggttcacccgcacgctcgcggcc
gaactgggtcctcacggcgtgacagtcaacgcgatagcaccgggcttcgtggccacgccg
atggtggacgagctgaccgaacggctcggcgtggaccgggaaacgttcctgcaggaggcg
gcgatgtcctcggccgtgggccggatcgggacgcccgaagaagtcgccgcgacggtggcc
tttctcacccacccggaatcgggctacctcacaggggagaccatccacgtcgaaggcggt
cggcgatga

DBGET integrated database retrieval system