KEGG   Nocardiopsis gilva: CDO52_02195
Entry
CDO52_02195       CDS       T05022                                 

Definition
(GenBank) hypothetical protein
  KO
K12704  novobiocin biosynthesis protein NovK
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00401  Novobiocin biosynthesis
ngv01100  Metabolic pathways
ngv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CDO52_02195
SSDB
Motif
Pfam: adh_short adh_short_C2 3HCDH_N DAO KR Pyr_redox_2 NAD_binding_8 NAD_binding_10 NmrA DFP
Other DBs
NCBI-ProteinID: ASU81755
UniProt: A0A223S0U2
LinkDB
Position
424281..425021
AA seq 246 aa
MTGVAVVAGGSGRTGLAVALRLAAGGHDVALLDTEFRAADKTVRRIEETGRRCLTVQAEL
ADAGSVDTAFGQVRTALGGPAVLVTCVGLGPPLPDGLPEDELADEQRYAAVRRALRRAFV
CCQAGAGQLLHQRSGRVIIVTEPVEGGENAWLTLQPVLGGLIGFTRSAALELARSGITVN
LIAPTDCAADSRAPAHQPAPKDGASSYAEGVAHVTEFLVDDQAVGITGQEIYVAAPEAGV
PLLHER
NT seq 741 nt   +upstreamnt  +downstreamnt
atgacaggagtcgcggtcgtggccggcggcagcgggcgaacgggcctggcggtcgcgctc
aggctggcggcgggcggccatgatgtcgccctgctggacaccgagttcagggcggccgac
aaaaccgtccgacggatcgaggagaccggtaggcggtgcctcacggtccaggccgagttg
gccgacgccgggtcggtcgacaccgctttcggccaggtgcgtaccgcgctggggggcccg
gccgtgctggtcacctgcgtcggactgggaccgccgctcccggacgggctgcccgaggac
gaactcgcggacgaacagcgctatgccgcggtacgacgggcgctgcgccgggcgttcgta
tgttgccaggctggcgccggtcagctgctgcaccagcggtcgggacgggtcatcatcgtc
accgagccggtcgaaggcggcgagaacgcctggctcaccctccaacctgtgctgggcggg
ctgatcgggttcacccggtccgcggcgttggagctggccaggtccggcatcaccgtgaac
ctcatcgcgccgaccgactgcgcggccgacagccgggccccggcgcaccaaccggcaccc
aaggacggcgcgagctcctacgcggagggggtcgcgcacgtgacggagttcctcgtcgac
gatcaagctgtcggaatcaccgggcaggagatctacgtcgccgctcccgaagcgggagta
cctctactccacgaaaggtag

DBGET integrated database retrieval system