KEGG   Nocardiopsis gilva: CDO52_02230
Entry
CDO52_02230       CDS       T05022                                 

Definition
(GenBank) hypothetical protein
  KO
K12707  4-hydroxyphenylpyruvate 3-dimethylallyltransferase [EC:2.5.1.111]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00401  Novobiocin biosynthesis
ngv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CDO52_02230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ngv01006]
    CDO52_02230
Enzymes [BR:ngv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.111  4-hydroxyphenylpyruvate 3-dimethylallyltransferase
     CDO52_02230
Prenyltransferases [BR:ngv01006]
 Compound prenylation
  ABBA prenyltransferase
   CDO52_02230
SSDB
Motif
Pfam: PTase_Orf2
Other DBs
NCBI-ProteinID: ASU81762
UniProt: A0A223S0U0
LinkDB
Position
433349..434410
AA seq 353 aa
MAPCAVNHESPGLSDLPPSHRRSGLTEEVMPALPVDQEFDGERFRADVRATADAIGAPFS
PRLTDTVLEAFRDNFAQGATLWKTTSKPGGQLSYRFFSRLKMDTVGRAIDAGLLDAAHPT
VPVVNAWSSLYGGAPVQSGDFDAGRGMAKTWLYFGGLRPAEDILTVPALPQPVQDRLKDF
LALGLAHIRFAAVDWRHHSANVYFRGQGPLDTGQFARIHALSGGTPPAADVVDEVLAYVP
EDYCVAITLDLHSGAIERVCFYALKVPKDALPRIPTHIARFLEVAPSHDPDECNVIGWSF
GRSGDYVKAERSYTGNMAEILSGWNCFFHGEEGRDHDLRVLHQDTGSTTGGAR
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggcgccttgcgccgtaaatcatgaaagtcctggcctgagcgatttaccgccatcccat
aggcggtcaggactgacggaggaagtcatgcccgctctcccggtagatcaagaattcgac
ggcgaacgctttcgcgccgatgtacgcgccaccgccgacgcgatcggcgcgccattctct
ccccgtcttaccgacaccgtcctcgaggccttccgtgacaacttcgcccagggcgcaacc
ctgtggaagaccaccagtaagcccgggggtcaactttcgtaccgtttcttctcccgcctc
aagatggacaccgtcggccgggccatagacgcggggctgttggacgccgcgcatccgacc
gtgcctgtcgtgaacgcctggagcagcctctacggcggcgcgccggtacagtcgggcgac
ttcgacgctgggcgcggaatggccaagacatggctgtacttcggcggcctgcggccagcc
gaggacattctcaccgttcccgctctgccgcagccggtgcaggaccggttgaaggacttc
ctcgcactgggcctggcacacatccggttcgcagcggtggactggcgccaccacagtgcg
aacgtctacttccgcggtcaaggtcctttggacacaggtcagttcgcccgcatccacgcc
ctgtccggcggcacaccacctgccgcggatgtcgtggacgaggtcctggcgtacgtgccc
gaggactactgcgtcgctatcaccctcgacctgcacagtggcgcgatcgagcgggtgtgc
ttctacgccctgaaagtccccaaggacgcgctaccacgcatccccactcacatcgccagg
ttccttgaggtggcgcccagccatgatccagatgagtgcaatgtcatcggctggtcgttc
ggtcgcagtggcgactacgtcaaggccgaacgcagctacaccggcaacatggccgagatc
ctgtccggctggaattgcttcttccacggtgaggaaggccgcgaccacgacctgcgcgta
cttcaccaagacacgggatcgaccacgggaggtgcccgatga

DBGET integrated database retrieval system