KEGG   Nocardiopsis gilva: CDO52_05670Help
Entry
CDO52_05670       CDS       T05022                                 

Gene name
ectB
Definition
(GenBank) diaminobutyrate--2-oxoglutarate transaminase
  KO
K00836  diaminobutyrate-2-oxoglutarate transaminase [EC:2.6.1.76]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00260  Glycine, serine and threonine metabolism
ngv01100  Metabolic pathways
ngv01120  Microbial metabolism in diverse environments
ngv01210  2-Oxocarboxylic acid metabolism
ngv01230  Biosynthesis of amino acids
Module
ngv_M00033  Ectoine biosynthesis, aspartate => ectoine
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDO52_05670 (ectB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ngv01007]
    CDO52_05670 (ectB)
Enzymes [BR:ngv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.76  diaminobutyrate---2-oxoglutarate transaminase
     CDO52_05670 (ectB)
Amino acid related enzymes [BR:ngv01007]
 Aminotransferase (transaminase)
  Class III
   CDO52_05670 (ectB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASU82344
UniProt: A0A223S2J0
LinkDB All DBs
Position
1186579..1187844
Genome map
AA seq 421 aa AA seqDB search
MEIFDRLESEVRSYCRSWPVVFNEARGSYIYDESGRPYLDFFAGAGSLNYGHNNPVLKSK
LIDYLASDGVVHSLDAYTTAKQEFLQTFGDVILGPRGLDYKVQFPGPAGNNAVEAALKLA
RKITGREVIVNFTNSFHGMTLGALAVTGNSMKRGGAGVPLTHVNTMPYDNYMDGETPDFL
WLRSVLEDSGSGLDKPAAVIVETVQGEGGINAASAEWLRGLAALCEEHGILLIVDDIQMG
CGRTGGFFSFEEAGIKPDIVTLSKSISGYGIPLALTLFKRELDVWGPGEHNGTFRGPNPA
FVTGTAALDTFWRDDELQKATLAKGELIRTRLTAIAEEFAEAGAHVRGRGMAAGLAFERE
GAASALSREAFQRGLLVETSGPEDEVAKLLPALTTTEEELEQGLDIMAEAARAAVKISQP
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggagatcttcgaccgcctcgaatccgaagtccggagctactgccgtagttggccggtc
gtcttcaacgaggcgcgaggcagctacatctacgacgagtcggggcggccttacctcgac
ttcttcgcgggtgccggttccctgaactacgggcataacaacccggtcctgaaatccaaa
ctcatcgactacctcgcgagcgacggcgtcgtgcacagcctcgacgcctacaccacggcg
aagcaggagttcctgcagacgttcggtgacgtcatcctgggcccgcgcgggctcgactac
aaggtgcagttccccggcccggccgggaacaacgccgtcgaggccgccctcaagctggcc
cggaagatcaccggccgcgaggtcatcgtcaacttcaccaacagcttccacggcatgacg
ctgggcgcgctcgccgtgaccggcaactcgatgaagcgtggcggcgcgggggtgccgctg
acgcacgtcaacaccatgccgtacgacaactacatggacggcgagacgccggacttcctg
tggctgcgcagcgtccttgaggacagcggcagtggcctggacaagccggccgccgtcatc
gtcgagacggtgcagggcgagggcggcatcaacgccgccagcgccgagtggctgcgcggg
ctcgccgccctgtgcgaggagcacggcatcctgctcatcgtcgacgacatccagatgggc
tgcgggcgcaccggcggcttcttcagcttcgaagaggccggcatcaagccggacatcgtc
acgctgtccaagtcgatcagcggctacggcatcccgctcgccctcacgctgttcaagcgt
gagctggacgtgtggggcccgggcgagcacaacgggaccttccgtggccccaaccccgcc
ttcgtcaccggcaccgccgcgctcgacacgttctggcgcgacgacgagctgcagaaggcc
accctcgccaagggtgagctcatccgcacgcgcctcaccgccatcgccgaggagttcgcc
gaggccggggcgcacgtgcgtggccgcggcatggcggccggcctggccttcgagcgtgag
ggcgccgcctcggcgctcagccgcgaggccttccagcgcggcctgctcgtcgagacctcc
ggtcccgaggacgaggtcgccaagctcctccccgcgctcaccacgaccgaggaggagctg
gagcagggcctggacatcatggccgaggccgcgcgcgccgcggtgaaaatctcgcagccc
gcataa

DBGET integrated database retrieval system