KEGG   Nocardiopsis gilva: CDO52_10805Help
Entry
CDO52_10805       CDS       T05022                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00071  Fatty acid degradation
ngv00072  Synthesis and degradation of ketone bodies
ngv00280  Valine, leucine and isoleucine degradation
ngv00310  Lysine degradation
ngv00362  Benzoate degradation
ngv00380  Tryptophan metabolism
ngv00620  Pyruvate metabolism
ngv00630  Glyoxylate and dicarboxylate metabolism
ngv00640  Propanoate metabolism
ngv00650  Butanoate metabolism
ngv00900  Terpenoid backbone biosynthesis
ngv01100  Metabolic pathways
ngv01110  Biosynthesis of secondary metabolites
ngv01120  Microbial metabolism in diverse environments
ngv01130  Biosynthesis of antibiotics
ngv01200  Carbon metabolism
ngv01212  Fatty acid metabolism
ngv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDO52_10805
   00630 Glyoxylate and dicarboxylate metabolism
    CDO52_10805
   00640 Propanoate metabolism
    CDO52_10805
   00650 Butanoate metabolism
    CDO52_10805
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDO52_10805
   00072 Synthesis and degradation of ketone bodies
    CDO52_10805
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDO52_10805
   00310 Lysine degradation
    CDO52_10805
   00380 Tryptophan metabolism
    CDO52_10805
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDO52_10805
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDO52_10805
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CDO52_10805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngv04147]
    CDO52_10805
Enzymes [BR:ngv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDO52_10805
Exosome [BR:ngv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDO52_10805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Cadherin_tail
Motif
Other DBs
NCBI-ProteinID: ASU83200
UniProt: A0A223S4Y1
LinkDB All DBs
Position
2362092..2363246
Genome map
AA seq 384 aa AA seqDB search
MAEAFIVDAVRSPVTRRGGGLSGVHPADLGAHVLTALMERTGADPAAVDDVILGCVDTIG
PQAGDIARTCWLAAGLPEEVPGVTVDRQCGSSQQAVHFAAQAVLSGTADLVVAGGVQNMS
QVPIGSAMTAAEGLGSTEGPFAGSEGWRRRYGTQEVSQFRGAEMIAQQWGITRDAMEEFA
LGSHQRAIHAIDSGRFDRETAPLGDVTTDEGPRRGTTRQAMAGLRPLVDGGRLTAALASQ
ISDGAAALLIASERAVATHGLTPRARIHHLSARGEDPVRMLSAPIPATAHALRRTGMRIG
DLDVLEVNEAFASVVLAWLKETGADPARVNPNGGGIALGHPLGATGARLMTTLLHELERV
GGRYGFQAMCEGGGQANVTVIERV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggctttcatcgtcgacgcggtgcgttcccctgtcaccaggcgaggcggcgga
ctgtccggcgtgcacccggccgatctgggcgcgcacgtcctcaccgcgctcatggaacgc
acgggcgccgaccccgccgccgtcgatgacgtcatcctcggctgcgtcgacaccatcggt
ccccaggccggggacatcgcccgcacctgctggctcgccgccggattgccggaggaggtg
ccgggcgtcaccgtcgatcggcagtgcggctcctcgcagcaggcggtgcacttcgctgcg
caggcggtgctgtccgggaccgccgacctggtcgtcgcgggcggggtgcagaacatgtcg
caggtccccatcggctccgcgatgaccgccgccgaagggctcggatccaccgagggaccc
ttcgccggttccgagggctggcggcgccggtacggcacgcaggaggtgtcgcagttccgc
ggtgccgagatgatcgcgcagcagtggggcatcacccgcgacgccatggaggagttcgcc
ctgggctcgcaccagcgggcgatccacgccatcgactccggccgcttcgaccgcgagacg
gcgcccctcggcgacgtcacaaccgacgaggggccgcggcgcgggacgacccgacaggcg
atggccggactgcgcccgcttgtcgacggcgggcggctcaccgcagcgctcgcatcgcag
atctccgacggcgccgcggcgctgctaatcgcctccgagcgggctgtggccacgcacggg
ctcaccccgagggcgcggatccaccacctgtcggcgcgcggtgaggacccggtgcgcatg
ctgtcggcgccgatcccggccaccgctcacgccctgcgccggacgggcatgcgcatcggc
gacctcgacgtgctggaggtcaacgaggcgttcgcgtcggttgtgctcgcctggctgaag
gagaccggtgccgaccccgcccgtgtcaacccgaacggcggcggcatcgcgctcggccac
cccctcggcgcgaccggcgcccggctgatgaccaccctgctccacgaactcgaacgcgtg
ggcggccgctacggcttccaggccatgtgcgagggcggcggtcaggccaacgtcacggtg
atcgagcgggtgtga

DBGET integrated database retrieval system