KEGG   Nocardiopsis gilva: CDO52_12240Help
Entry
CDO52_12240       CDS       T05022                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
ngv  Nocardiopsis gilva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASU83450
UniProt: A0A223S5P0
LinkDB All DBs
Position
complement(2693290..2694726)
Genome map
AA seq 478 aa AA seqDB search
MRKHDRLYIGGEWVEPAGTGTIDVVSPHTEEAIGQAPEGTAADMDRAVAAARAAFDHGPW
PRMAPGERAAVLTRLAELYEARLDEVAGLVTAEMGCPLTLSNLAQASLPQRTLAYFGGLA
DDVTWEETREGLLGPTRVVSEPVGVVAAITPWNVPQLLIIAKVAPALLAGCTVVVKPAPE
TALDPYVLAELAEEAGVPAGVLNIVAADRAVGEHLVTHPGVDHVAFTGSTAAGRRIATLC
GERLRGCGLELGGKSAAILLPDADLTAYTGMLTLTALLNNGEACVAQARVLAPRERYTEV
VDALAARLAELSVGDPADPSTDIGPLVSPAQRERVEGYIDLGRAEGARLVAGGGRPASAQ
RGYYVEPTLFADVDNRMRIAREEIFGPVLTVIPYDDERHAVDLANDSEYGLAGSVWTADP
EHGIAVARRIHTGSCGVNMYNIDVNTPFGGRKSSGLGYEYGPEGLREYLEFKSIATMG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagcacgaccggctctacatcggcggggagtgggtggagcccgccgggaccgga
acgatcgatgtggtgtcgccgcacaccgaggaggccatcgggcaggcccccgagggcaca
gccgccgacatggaccgcgccgtggccgccgcccgcgcggcgttcgaccacggcccctgg
ccgcgtatggcgcccggggagcgagcggcggtcctcacccggctggccgagctctacgag
gcgcgcctcgacgaggtcgccggactggtcaccgccgagatgggctgcccgctgaccctg
tcgaacctcgcccaggcgtccctgccacagcgcacgctcgcctacttcggcggcctcgcc
gacgacgtcacctgggaggagacccgcgaagggctcctcgggccgacgcgcgtcgtcagc
gaaccggtgggggtggtcgccgcgatcaccccgtggaacgtcccgcagcttctcatcatc
gccaaggtcgccccggcgctgctcgccggatgcacggtggtggtcaagcccgcgccggag
accgcgctcgacccctacgtcctcgccgagctcgccgaggaggcgggtgtccccgccggt
gtgctcaacatcgtcgcggccgaccgcgcggtcggggagcacctcgtcacccaccccggg
gtggaccacgtcgcgttcaccggctccaccgccgcaggacggcgcatcgcgaccctgtgc
ggcgagcggctgcgcgggtgcggcctggagctcggtggaaagtccgcggcgatcctgctc
ccggacgcggacctgaccgcctacaccggcatgctgacgctgaccgcgctcctcaacaac
ggcgaggcctgcgtcgcgcaggcgcgggtcctggcgccgcgcgagcgctacaccgaggtc
gtcgacgcccttgccgcgcgcctggccgagctctccgtcggcgacccggcggacccgtcc
accgacatcggaccgctggtctcgcccgcccagcgggagcgggtggagggctacatcgac
ctgggtcgcgccgagggcgcgcggctcgtcgcgggcgggggccgtccggcgtccgcacag
cgggggtactacgtcgagcccaccctcttcgccgacgtcgacaaccgcatgcgcatcgcc
cgcgaggagatcttcggcccggtcctcacggtgatcccctacgacgacgagcgccatgcg
gtcgacctcgccaacgacagcgagtacggcctggccgggtcggtgtggaccgccgacccg
gagcacggcatcgccgtcgcccgccggatccacaccggcagctgcggggtgaacatgtac
aacatcgacgtcaacacgcccttcggcgggcgcaagtccagcggcctgggatacgagtac
gggccggagggcctgcgggagtacctggagttcaagtcgatcgcgacaatggggtga

DBGET integrated database retrieval system