KEGG   Nocardiopsis gilva: CDO52_13050Help
Entry
CDO52_13050       CDS       T05022                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
ngv  Nocardiopsis gilva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase DNA_ligase_A_C PNKP_ligase MaoC_dehydrat_N
Motif
Other DBs
NCBI-ProteinID: ASU83597
UniProt: A0A223S629
LinkDB All DBs
Position
2842604..2843572
Genome map
AA seq 322 aa AA seqDB search
MVPERMLAKTVTAMPVGDHLVYEPKWDGFRTRVTTGPTRIVSKSGYITNQRWPELVAALD
TLPDGLLLDGEIVCWRDGRLSFDALLRRNTASPRRARGLARTQPAHFVAFDLLREDGEEI
WHQPLRDRRQRLEALFAADHDPHLDLAWQTADPDEARDWYEHLTDVGIEGLIIKDSREPY
RPGKRAWYKYKNLQTTEAIVGAVVGSVEAPTALVLGRHDPETGELRIVGRTSPLSPPQQR
DLAPLLEEASSGHPWPGGNAPALGPSRAAPYTRVTPDVVVEVAPDTGVAAGRWRHSVRYV
RVRPDLSVDEVPQGLDIERRSG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtggtcccggaacgcatgctcgcgaagaccgtcactgcaatgccggtcggcgaccacctg
gtctatgagccgaaatgggacgggttccgtacaagggtgacaaccgggccgacgcggatt
gtgtcgaagtccggatacatcaccaaccagcggtggccggagctggtggccgccctcgac
acccttcccgacgggttgttgctagacggcgagatcgtgtgttggcgtgacggtcggcta
agtttcgatgccctgttgcgccgcaacaccgccagtccgcggcgggcacgcggcctcgcg
cgaacccaacccgcgcatttcgtggccttcgacctgctccgagaagacggtgaagagatc
tggcaccagcctctgcgcgaccggcgccagcgcctcgaagccctgttcgccgccgatcac
gacccccacctggacctggcgtggcagaccgcggaccccgatgaggcccgcgactggtat
gagcacctgacggacgtcggcatcgaggggctgatcatcaaagattcccgtgagccctac
cggccgggcaaacgcgcctggtacaagtacaaaaacctgcaaaccaccgaggcgatcgtc
ggcgcggtggtggggagcgtggaggcgccgaccgcgctcgtgctgggccgccacgacccg
gagacgggggagctgcggatcgttggtcgcacctccccgctctccccgccccagcagagg
gatctcgcgccgctgctggaggaggccagcagcggccacccgtggcccggcggaaacgcg
cccgccctcggcccctcccgtgcggccccctacacccgcgtcaccccggacgtggtggtg
gaggttgcccccgacaccggagtcgcggccgggaggtggcgccactcggtgcggtacgtc
cgagttcgcccggacctgtcggtggacgaggtgccccaggggttggatatcgagcgccgg
tcaggctga

DBGET integrated database retrieval system