KEGG   Nocardiopsis gilva: CDO52_14345Help
Entry
CDO52_14345       CDS       T05022                                 

Definition
(GenBank) histidine kinase
Organism
ngv  Nocardiopsis gilva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GAF_2 GAF GAF_3 HisKA_3 HATPase_c HATPase_c_2 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ASU83804
UniProt: A0A223S6Q0
LinkDB All DBs
Position
complement(3155283..3157004)
Genome map
AA seq 573 aa AA seqDB search
MADPRPDDTGRERLLLPQMRLDDLLDEVQSRMATIMATRDRIHALLEAVITIGEGLELET
LLRRVTEAAVTLVNARYGAIGVIGPNGELTRFIPVGVSEEQIAQIDHWPRGEGILGLLIK
EPRPLRLSAITDHPESAGFPARHPEMRSFLGVPIRVRDDVFGNLYLSDKTDGDDFDEDDE
TLVLALATAAGVAIENAHLFEETRRRETWLDASGEITTRLLSGARTDEVLRLVARRARMM
SEADLALIALPENDQERLVVQVCEGIDVTEGRGQAIDTAETLVGRVYARGEPRLADVTAH
ASRDAEFLRGLGLGPVLLVPFGPPERVRGVLVVGSRPGRSPFPESVQDMLFTFADHAAVA
LELAETRHTAERLSVLEDRDRIARDLHDIVIQRLFATAMSLMGAVNRISDRESTERVQRA
VDDLDDTIRQIRSTIFELQHTNENDEENWLRAQILDVVNNSAGTLGFSPRLLLEGPIDSA
VEPSIADQLLAVLQEALSNVARHARASHVGVDIRVRDEAVAVRVEDNGAGIPKQVRRSGL
RNVRTRADQLGGEFETRPRDGGGTVFHWRVPLA
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggccgatccgcggcctgacgacacgggccgggagcgtctcctgctgccacagatgcgg
ctggacgacctgctggatgaggtgcagtcgcggatggccacgatcatggcgacccgcgac
cggatccacgcgctgctggaagccgtcatcaccatcggtgagggcctggagctggagacc
ctgctgcgccgggtcaccgaggccgccgtgacgctggtgaacgcgcgctacggcgcgatc
ggcgtgatcggtccgaacggggagctcacccggttcatcccggtcggcgtcagcgaggag
cagatcgcccagatcgaccactggccgcgcggcgaaggcatcctcggcctgctcatcaag
gagccgcgtcccctgcggctctccgcgatcaccgaccaccccgagtcggccggctttccc
gcgagacaccccgagatgcgcagcttcctgggtgtccccatccgcgtgcgcgatgacgtg
ttcggcaacctctacctgagcgacaagaccgacggcgatgacttcgacgaggacgacgag
acactcgtgctcgccctagccaccgcggccggggtggccatcgagaacgcgcacctgttc
gaggagacccggcgccgggagacctggctggacgcctccggggagatcaccacgcgcctg
ttgtcgggggcccgcaccgatgaggtgctgcggctggtggcccggcgggcgcggatgatg
tcggaggccgatctggcgctcatcgcgcttcccgagaacgaccaggagcgcctggtcgtg
caggtgtgcgagggcatcgacgtcaccgagggccgggggcaggccatcgataccgcggaa
accctggtcggccgggtctacgcccggggcgagccgcggctcgccgatgtcaccgcccac
gccagccgcgacgccgagttcctccgcgggctggggctgggtccggtgctgctggtgccg
ttcggcccgcccgagcgggtgcgcggcgtgctcgtcgtgggcagccggccgggccgctcc
cccttcccggagtcggtgcaggacatgctcttcaccttcgccgaccacgcagctgtcgcc
ctggagctggccgagacccggcacaccgcggagcgcctcagcgtgctggaggaccgcgac
cggatcgcccgcgacctgcacgacatcgtgatccagcggctcttcgccacggccatgtcg
ctcatgggcgcggtgaaccggatctcggaccgggagtcgacggagcgtgtacaacgggcc
gtggacgatctcgacgacacgatccggcagatccgctcgacaatcttcgagctgcagcac
accaacgagaacgacgaagagaactggctgcgcgcccagatcctggacgtggtgaacaac
tccgccgggactctgggcttctcaccgcggctgctgctggagggtcccatcgacagcgca
gtcgagccgagcatcgccgaccagctgctcgccgtgctgcaggaggccctgtccaacgtg
gcgcggcatgcccgcgcctcccacgtcggcgtcgacatccgcgtccgggacgaggcggtg
gccgtgcgggtggaggacaacggggcgggcatccccaagcaggtgcgccggagcgggctg
cgcaacgtgcggacgcgcgccgatcaactcggcggcgagttcgagacccgcccgcgcgat
ggcggtggcaccgtcttccactggcgcgtcccgctggcctga

DBGET integrated database retrieval system