KEGG   Nocardiopsis gilva: CDO52_16180Help
Entry
CDO52_16180       CDS       T05022                                 

Definition
(GenBank) mycofactocin system FadH/OYE family oxidoreductase 2
Organism
ngv  Nocardiopsis gilva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN FAD_oxidored Pyr_redox_2 NAD_binding_8 FAD_binding_2 HI0933_like Pyr_redox GIDA FAD_binding_3 Pyr_redox_3 NAD_binding_7 AlaDh_PNT_C DDE_3 Thi4 Dus
Motif
Other DBs
NCBI-ProteinID: ASU84122
UniProt: A0A223S7T5
LinkDB All DBs
Position
3546416..3548494
Genome map
AA seq 692 aa AA seqDB search
MNPPGPAAGRGTYRHLFTPLRLGPLTVANRIVFCAHLTNYADNGRPTAQHAAYYAARAAG
GAGLIITEEHSTHPTDRPYEKLIEGYAPGVVDDYRRLTDAVHAHDVPILAQLNHNGGQAS
SMYTRLPVWAPSPIADPLFGEVPKAVEEHEITEITDAYAQVAAHCVAGGFDGVELQCSHS
SIVRAFLSPATNHRTDRWGGPLPNRARLLLHLIDAVRAAVGPDRVVGVRLCGDELIEGGT
TIDEAVEVARMVDATGQVDYLNTSIGVATHTLHMVEASMRVPPGYAAYIPTAIRAAVRLP
VVGVGRFKDPLQADRALGAGHADLVGVVRGQIADPDFAAKARSGHAEEIRTCLSCNQECV
GRMGLNRWLGCIENPHAGHEAAPADSAGAAGAAGARGESGGVAAPAAVSLPATGAVWGRP
GRRVLVVGGGPGGLQAAVSAAERGHRVTLIEREGQLGGQVPIAARAPGRAEFLDLTRNLA
AHVRRLGVDVELGTEADAQMLAARRPHAVVLATGAVPAAPWWAHGHARAVDVRDVLQGRA
DPAGRVVVVDELGFHQATSVAELLAERGCEVEVMTPALVVGQDLGITLDLETWNVKADAL
GIRQSTDRVPMGAEELPGPAGGVLLRLQHHPTGAEETREVDWVVCAVHQRPDDDLWHALH
GSPFTVHRVGDCLAPRRAHAAVAEGHAVAVGL
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgcccgggcccgccgccggacgcggcacctaccgccacctgttcaccccgctg
cgcctgggcccactgacggtagccaaccgcatcgtgttctgcgcccacctgaccaactac
gccgacaacggccgccccaccgcccagcacgcggcctactacgccgcccgcgcggcgggc
ggggccgggctgatcatcaccgaggagcactccacccaccccaccgaccgcccctacgaa
aaactcatcgagggctatgcgcccggcgtcgtcgacgactaccggcgcctcaccgatgcc
gtccacgcccacgacgtgccgatcctggcccagctcaaccacaacggcgggcaggccagc
tccatgtacacccggctgccggtgtgggcgcccagcccgatcgccgacccgctgttcggc
gaggtgcccaaggcggtcgaggagcacgagatcaccgagatcaccgacgcctacgcccag
gtggccgcccactgtgtggcgggcggtttcgacggggtggagctgcagtgctcgcactcc
tccatcgtccgcgccttcctctccccggccaccaaccaccgcaccgaccgctggggcggc
ccactgcccaaccgcgcacggctcctgctgcacctcatcgacgccgtgcgcgcggccgtg
ggaccggaccgggtcgtgggggtgcgcctgtgcggggacgagctgatcgagggcggcacc
accatcgacgaggcggtggaggtggcccggatggtggacgccaccggccaggtcgactac
ctcaacacctccatcggggtggccacccacaccctgcacatggtcgaggcgagcatgcgc
gtcccgccgggctatgccgcctacatccccaccgcgatccgcgcggcggtgcgcctcccg
gtggtgggggtgggccgcttcaaggacccgctgcaggccgaccgggccctgggtgccggg
cacgccgacctcgtcggtgtggtgcgcgggcagatcgccgaccccgacttcgccgccaag
gcgcgctccggccacgccgaggagatccgcacctgcctgtcgtgcaaccaggagtgcgtg
gggcgcatggggctcaaccggtggctggggtgcatcgagaacccgcacgcgggacacgag
gcggcaccggcagactcggcgggcgccgccggggctgccggtgcgcgcggtgagagcggc
ggggtggcggccccggccgcggtctcccttccggccaccggggccgtgtgggggcgaccg
gggcggcgcgtgctggtcgtgggcggtggaccgggcggcctgcaggccgcggtcagcgcc
gccgagcgcggccatagggtcaccctcatcgagcgcgagggacagctgggcggccaggtg
cccatcgccgcgcgggcgcccggccgcgccgagttcctcgacctcacccgcaacctcgcc
gcccacgtccgccgcctgggcgtcgatgtcgaactcgggaccgaggccgatgcccagatg
ctcgcggcgcggcgcccgcacgcggtggtcctggcgaccggcgccgtgcccgcggcaccg
tggtgggcccacgggcacgcgcgcgcggtggacgtccgcgacgtcctccaggggcgggcg
gacccggccgggcgcgtggtggtcgtcgacgagctgggcttccaccaggccacctcggtg
gccgagctactggccgaacggggatgcgaggtggaggtgatgaccccggccctggtcgtc
ggccaggacctggggatcaccctcgacctggagacctggaacgtgaaggcggacgcactg
gggatccgccagagcaccgaccgggtgccgatgggcgccgaggaactgccgggcccggcg
ggcggggtgctgctgcgtctccagcaccaccccacgggagccgaggagacgcgggaggtg
gactgggtggtgtgcgccgtgcaccagcggcccgacgacgacctgtggcacgccctgcac
ggctcccccttcaccgtccaccgcgtcggcgactgcctggccccgcgccgcgcgcacgcg
gccgtcgccgaaggccacgccgtggcggtgggcctatga

DBGET integrated database retrieval system