KEGG   Nocardiopsis gilva: CDO52_17460Help
Entry
CDO52_17460       CDS       T05022                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00061  Fatty acid biosynthesis
ngv00780  Biotin metabolism
ngv01100  Metabolic pathways
ngv01130  Biosynthesis of antibiotics
ngv01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CDO52_17460
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CDO52_17460
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CDO52_17460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ngv01004]
    CDO52_17460
Enzymes [BR:ngv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CDO52_17460
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CDO52_17460
Lipid biosynthesis proteins [BR:ngv01004]
 Fatty acid synthase
  Component type
   CDO52_17460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Oxidored_nitro SbcD_C
Motif
Other DBs
NCBI-ProteinID: ASU84348
UniProt: A0A223S8B9
LinkDB All DBs
Position
complement(3850223..3850987)
Genome map
AA seq 254 aa AA seqDB search
MGILEGKRILVTGVITDSSIAFHVARLCQEQGATVVLTGYGRLSLVERIAQRLPEAAPVL
ELDVTDEDHLNSLADRIRKHVDGIDGIVHSIGFTPQGALGGNFLDTAWEDVATAMHTSTF
SLKSLTTAVLPLMSDGGSVVAMDFDNSVSYPVYDWMGVAKSGLTSTARYLARYLGEQKIR
VNLVSAGPLRTMAARSIPGFDELAGHWPERAPLGWDTSDPEPAARAVVALLSDWFPATTG
EIVHVDGGFHSTGA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggaattcttgagggcaagcgcatcctcgtcaccggggtgatcaccgactcctcgatc
gccttccacgtcgcccgcctctgccaggagcagggcgccacggtcgtgctcaccggctac
ggccgcctgagcctcgtcgagcgcatcgcgcagcggctccccgaggccgcgcccgtgctc
gaactcgacgtcaccgacgaggaccacctcaacagcctcgccgaccggatccgcaagcac
gtcgacggcatcgacggcatcgtccactccatcggcttcaccccccagggcgccctgggc
ggcaacttcctcgacaccgcgtgggaggacgtcgccaccgcgatgcacacctccacgttc
tcgctgaagtcgctgaccaccgcggtgctgccgctgatgtccgacggcggctccgtggtc
gccatggacttcgacaacagcgtctcctaccccgtctacgactggatgggcgtcgccaag
tccgggctcacctccaccgcccgctacctcgcccgctacctcggcgagcagaagatccgg
gtcaacctcgtctccgccgggccgctgcgcaccatggccgcgcgcagcatccccggcttc
gacgagctcgccgggcactggcccgagcgcgccccgctcggctgggacacctccgacccc
gagccggccgcgcgcgccgtcgtggcgctgctgtccgactggttccccgccacgaccggc
gagatcgtccacgtcgacggcgggttccactccacaggggcgtaa

DBGET integrated database retrieval system