KEGG   Nocardiopsis gilva: CDO52_19115Help
Entry
CDO52_19115       CDS       T05022                                 

Definition
(GenBank) acetylornithine aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00220  Arginine biosynthesis
ngv00300  Lysine biosynthesis
ngv01100  Metabolic pathways
ngv01110  Biosynthesis of secondary metabolites
ngv01120  Microbial metabolism in diverse environments
ngv01210  2-Oxocarboxylic acid metabolism
ngv01230  Biosynthesis of amino acids
Module
ngv_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
ngv_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    CDO52_19115
   00220 Arginine biosynthesis
    CDO52_19115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ngv01007]
    CDO52_19115
Enzymes [BR:ngv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     CDO52_19115
    2.6.1.17  succinyldiaminopimelate transaminase
     CDO52_19115
Amino acid related enzymes [BR:ngv01007]
 Aminotransferase (transaminase)
  Class III
   CDO52_19115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase B277
Motif
Other DBs
NCBI-ProteinID: ASU84628
UniProt: A0A223S947
LinkDB All DBs
Position
complement(4246594..4247934)
Genome map
AA seq 446 aa AA seqDB search
MSGAGETNGTAGTATSAAGLRDRFQAALMPTYGTPGIVLARGQGSTVWDVEGTRYLDLIA
GIAVSALGHGHPALVKAVTDQTATLAHTSNLFIHEREVELAERLIGLLRGATTGGRSGQG
EPGAAADDIRVFFANSGTEANEAALKLVKADAAARGLSTGDRSGSTRPGYIVSTGNAFHG
RTSGALALTGKAAIREKFGPFGMDVRFVPYGDADALRDAVDDSCAAVIVEPTQGEAGVIP
APEDYLARIRAICDATGAAFILDEIQSGIGRTGHWFAHQGAGVTPDVLTLAKGLGGGLPI
GVCVGFGRYATAFAKGDHGSTFGGNPVACAAALAVLDTIEADGLLANATDLGALLTAELT
AIDHPLITGVRGAGLWLGIQLSAPVAADVQDHAAAHGFLVNAVTPDTIRIAPPLTISRSE
VLEFTGAFPAILAAATPPASETGGTA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgcgggggagacgaacggcaccgcgggcacggccacgagcgcggccgggctg
cgcgaccggttccaggccgccctcatgcccacctacggcacccccggcatcgtgctcgcg
cgtggccagggcagcacggtgtgggacgtcgagggaacccgctacctcgacctcatcgcc
gggatcgccgtctccgccctcggccacggccacccggccctggtcaaggccgtcaccgac
cagaccgcgacgctcgcccacaccagcaacctgttcatccacgagcgcgaggtcgagctc
gccgaacgcctcatcggcctgctccggggcgcgaccaccggcggccgcagcgggcagggc
gaaccgggcgccgcggccgacgacatccgcgtcttcttcgccaactccggcaccgaggcc
aacgaggccgcgctcaagctggtgaaggccgacgcggcggcccggggcctgagtaccggt
gacaggtccggctccacccgcccgggctatatcgtctcgaccggcaacgccttccacggc
cgcacctccggcgcgctcgcgctcaccggcaaggccgccatccgcgagaagttcgggccg
ttcggcatggacgtgcggttcgtgccgtacggcgacgccgacgcgctccgcgacgccgtc
gacgactcctgcgccgccgtgatcgtcgaacccacccagggcgaggccggggtgatcccc
gccccggaggactacctggcccggatccgcgccatctgcgacgccaccggcgccgcgttc
atcctcgacgagatccagagcggcatcggccgcaccgggcactggttcgcccaccagggc
gccggtgtcacccccgacgtcctgaccctcgccaagggcctgggcggcggcctgcccatc
ggcgtctgcgtcggcttcggccgctacgccaccgccttcgccaagggcgaccacggctcc
accttcggcggcaaccccgtggcctgcgcggcggccctggccgtactcgacaccatcgag
gccgacgggctcctggccaacgccaccgacctcggcgcgctgctcaccgccgagctcacc
gccatcgaccacccgctgatcaccggggtccgcggggccgggctctggctcggcatccag
ctctccgcgcccgtggccgccgacgtccaggaccacgccgccgcgcacggcttcctggtc
aacgcggtcacccccgacaccatccgcatcgccccgccgctgacgatctcccgctccgag
gtgctcgagttcaccggagcgttccccgcgatcctcgccgcagccaccccgccggcgagc
gagacaggaggtacggcatga

DBGET integrated database retrieval system