KEGG   Nocardiopsis gilva: CDO52_19145Help
Entry
CDO52_19145       CDS       T05022                                 

Definition
(GenBank) aspartate aminotransferase family protein
Organism
ngv  Nocardiopsis gilva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ASU84634
UniProt: A0A223S934
LinkDB All DBs
Position
complement(4253728..4254996)
Genome map
AA seq 422 aa AA seqDB search
MHDVTRTQKFMVTRAEGVWLWDDSGDRYLDGTASLWYCNVGHGRTEIADAVHQQMTRLDA
YTVYGDFANGPALELGERLTAHAPVVDPRVILTCGGGESIDTAAKLARRYWGVTGHPGKT
HLISRTGGYHGLHGFGSSIIGMERFRAGFGPLIEDVSVIPHDSVEALEAEILRVGPENVA
AFFAEPVIGAGGVYPPPGPEYFGAVAEVCRRHGVLFVVDSVICGFARMGTWFGIERYGVR
PDMIVFAKGVSSGYLPLGGVIVSGEVAEPFWNRPGNPFLHGTTYAGHPACCAAGMANLDI
LEREDLFTVSLEIEAQLDAAVRQLADHPMVGEVRAGTGVMAAVELSSEALDERGITTAEV
FLEARSRGVILRPVPRALLVSPPLIITWEQIEHLVGTLRSALDAVSAAHDGAQPGTAGAA
GD
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacgtcacgcggacccagaagttcatggtgacccgggccgagggcgtgtggctg
tgggacgacagcggcgatcgctacctcgatggcacggcgagcctgtggtactgcaacgtg
gggcacgggcgcacggagatcgccgacgccgtccaccagcagatgacccgactcgacgcc
tacaccgtgtacggcgacttcgccaacggtcccgcgctggagctcggcgagcggctgacc
gcgcacgcgccggtggtcgacccccgggtgatcctgacctgcgggggcggggagtccatc
gacaccgcggcgaagctggcccgccgctactggggggtgaccggccaccccggcaagacc
cacctgatcagccgtaccggcggctaccacggcctgcacgggttcggcagcagcatcatc
ggcatggagcgcttccgtgccgggttcggcccgctgatcgaggacgtctccgtcatcccg
cacgactcggtcgaggccctggaagccgagatcctgcgcgtcggcccggagaacgtcgcc
gcgttcttcgccgaacccgtcatcggcgccggcggggtctacccgccgcccggaccggag
tacttcggtgccgtggccgaggtgtgccgccgtcacggggtgctgttcgtcgtcgacagt
gtcatctgcgggttcgcccgcatgggcacatggttcgggatcgagcgctacggcgtccgc
cccgacatgatcgtcttcgccaagggcgtcagcagcggctacctcccgctgggcggggtc
atcgtcagcggggaggtggccgagccgttctggaaccggccgggcaaccccttcctgcac
gggacgacgtacgcggggcacccggcgtgctgcgcggcgggcatggccaacctcgacatc
ctcgagcgcgaggacctcttcacggtctcgctggagatcgaggcgcagctggacgccgcc
gtgcgccagctcgccgaccacccgatggtcggcgaggtccgggcgggcaccggcgtgatg
gcggccgtggaactgtcgtcggaggccctggacgagcgggggatcaccacggccgaggtg
ttcctcgaggcgcggtcgcgcggggtgatcctgcgcccggtgccgcgcgccctgctggtc
tcaccgccgctgatcatcacctgggagcagatcgagcacctggtgggcacgctgcgctcc
gccctggacgcggtctcggccgcgcacgacggcgcgcagcccggcacggcgggtgccgcg
ggcgactga

DBGET integrated database retrieval system