KEGG   Nocardiopsis gilva: CDO52_21235Help
Entry
CDO52_21235       CDS       T05022                                 

Definition
(GenBank) adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA
  KO
K00833  adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00780  Biotin metabolism
ngv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CDO52_21235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ngv01007]
    CDO52_21235
Enzymes [BR:ngv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     CDO52_21235
Amino acid related enzymes [BR:ngv01007]
 Aminotransferase (transaminase)
  Class III
   CDO52_21235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASU84981
UniProt: A0A223SA37
LinkDB All DBs
Position
complement(4752398..4753762)
Genome map
AA seq 454 aa AA seqDB search
MTPRVTSQPETRPAPAPDAGADPAWVREVDRAHLWHPYSSIGSGPAPGVVHGAAGTRIRL
TGEDGVERDVVDGMSSWWSMIHGYAHPVLDAAVRAQLDRFGHVMFGGLTHEPAARLAAAL
VDITPAPLRHVFLADSGSVSVEVAVKMCLQYWRSQGRPAKQRLLTWRGGYHGDTFQAMSV
CDPEGGMHALWGDVLPRQVFADAPPAGYDAAPDPAYIDHLDGLVAEHADELAAVIVEPVV
QGAGGMRFHSPAYLRALREITERHGVLLVFDEIATGFGRTGEMFAADHAGVAPDVMCVGK
ALTGGYMTLAAALCTAEVAQGIAEGEVPVLAHGPTFMGNPLACAVAVASIDLLRSGDWRG
DVARVASGLRAGLAPARDLPGVRDVRVLGAIGVIQLDRPVDMAAATEAALNAGAWLRPFR
DMIYAMPPYVCADADIERITDGMLAAARVSVEVR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacgccacgagtgaccagtcaaccggagacacgaccggcaccggctcctgacgcaggg
gccgatcccgcgtgggtgcgtgaggtcgaccgggcccacctctggcacccctactcctcc
atcggctcgggccccgcccccggcgtcgtgcacggtgcggcgggcacccggatccgcctg
accggcgaggacggtgtcgagcgcgatgtcgtggacggcatgtcctcctggtggtcgatg
atccacggctacgcccacccggtgctcgacgcggccgtgcgcgcgcagctcgaccggttc
gggcacgtcatgttcggcggtctcacccacgaacccgccgcgcggctggccgccgccctc
gtcgacatcacgcccgccccgttgcggcacgtgttcctggccgactccggatcggtgtcg
gtggaggtggccgtgaagatgtgcctgcagtactggcgctcgcagggccgcccggccaag
cagcgcctgctcacctggcgcggcggctaccacggcgacaccttccaggcgatgtcggtc
tgcgaccccgagggcggcatgcacgcgctgtggggtgatgtcctgccccggcaggtgttc
gccgacgccccgcccgccgggtacgacgccgcgcctgaccccgcctacatcgaccacctc
gacggtctcgtcgccgagcacgccgacgaactcgcggccgtgatcgtcgaacccgtggtg
cagggcgccggaggcatgcgcttccacagccccgcctacctgagggcgctgcgcgagatc
accgaacggcacggcgtgctgctggtgttcgacgagatcgccaccggcttcggccgcacg
ggagagatgttcgcggccgaccatgccggggtcgcccccgacgtgatgtgcgtgggcaag
gcgctcaccggcggctacatgaccctggcggcggccctgtgcaccgcggaggtggcccag
ggcatcgccgagggcgaggtcccggtcctcgcgcacggccccacgttcatgggcaacccg
ctggcctgcgcggtcgccgtcgcctccatcgacctcctgcggagcggcgactggcggggc
gacgtcgcgcgcgtcgcatccggcctgcgcgcgggcctggccccggcccgcgacctgccc
ggagtccgcgacgtgcgggtgctcggagcgatcggcgtgatccagctcgaccgcccggtc
gacatggcagccgccaccgaggccgccctgaacgccggagcgtggctgcgcccgttccgc
gacatgatctacgcgatgccgccctatgtctgcgccgacgccgacatcgagcggatcacc
gacgggatgctggccgccgcacgcgtctcggtggaggtgcgatga

DBGET integrated database retrieval system