KEGG   Nocardiopsis gilva: CDO52_21250Help
Entry
CDO52_21250       CDS       T05022                                 

Gene name
rocD
Definition
(GenBank) ornithine--oxo-acid transaminase
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00330  Arginine and proline metabolism
ngv01100  Metabolic pathways
ngv01110  Biosynthesis of secondary metabolites
ngv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CDO52_21250 (rocD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ngv01007]
    CDO52_21250 (rocD)
Enzymes [BR:ngv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     CDO52_21250 (rocD)
Amino acid related enzymes [BR:ngv01007]
 Aminotransferase (transaminase)
  Class III
   CDO52_21250 (rocD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ASU84982
UniProt: A0A223SA50
LinkDB All DBs
Position
complement(4757225..4758502)
Genome map
AA seq 425 aa AA seqDB search
MSDTRSLGEYTAGGDHTGPVISSSDHIGLAEAHSAHNYNPLPVVIAEGEGAWVTDVEGRR
YLDCLAGYSATNFGHSNPDLLAAAHHQLDRVTLTSRAFYHDQFGPWVTALADLVGKEKVL
PMNTGAEAVETAVKVARRWAYDVKGVPDGQATIIVAGGNFHGRTTTIISFSEDPDAYGGF
GPYTPGFRVVPYGDADAIASAIDATTAAVIVEPVQGEAGVIVPPPDYLPRIREICDDNRV
LFIADEVQSALGRTGTVTACEHTGVIPDAYLFGKALGGGILPVSAMVADEDVLGVIQPGQ
HGSTFGGNPMAAAMGRTVVRMLREGPYLDNAQRLGEVLGTRIKEFVGNGAVAARSIGLWA
GVDVDESLASGRELCERLAKKGVLVKDTHGSTVRLSPSLVVTEDDLNWALDRFGEVLAEL
RAEKG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacccgcagtctgggcgaatacacggccggtggggatcacaccggtcccgtc
atttcgagtagcgaccacatcggactggccgaggcacactcggcgcacaactacaacccc
ctgcccgttgtcatcgccgaaggcgagggcgcgtgggtcaccgacgtcgagggccgccgc
tacctcgactgtctcgccggatactccgcgaccaacttcggccacagcaaccccgacctg
ctggcggccgcacaccaccagctcgaccgggtgacgctcaccagccgcgccttctaccac
gaccagttcggcccctgggtcaccgccctcgccgacctcgtcggcaaggagaaggtgctg
cccatgaacaccggcgccgaggcggtggagaccgcggtcaaggtggcccgccggtgggcc
tacgacgtcaagggcgtccccgacgggcaggccacgatcatcgtcgcgggcggcaacttc
cacggccgcaccaccaccatcatctccttctccgaggaccccgacgcctacggcggcttc
ggtccctacacccccggcttccgcgtggtcccctacggcgacgccgacgcgatcgcgtcg
gccatcgacgcgaccacggccgcggtcatcgtcgagcccgtgcagggcgaggccggggtc
atcgtgccgcccccggactacctcccccgcatcagggagatctgcgacgacaaccgggtg
ctgttcatcgccgacgaggtgcagtcggccctcggccgcaccggcaccgtgacggcctgc
gagcacaccggcgtcatccccgacgcctacctcttcggcaaggccctgggcggcggcatc
ctccccgtctcggccatggtcgccgacgaggacgtcctcggcgtgatccagccgggccag
cacggcagcaccttcggcggaaacccgatggccgcggcgatgggccgcaccgtcgtgcgg
atgctgcgggaggggccctacctggacaacgcccagcggctcggcgaggtgctgggcacc
cggatcaaggagttcgtcggcaacggcgcggtggccgcgcgcagcatcgggctgtgggcg
ggggtcgacgtcgacgagtccctggccagcgggcgggagctgtgcgagcggctcgccaag
aagggcgtcctggtcaaggacacgcacggctcgacggtccggctctcgccgtccctcgtc
gtcaccgaggacgacctgaactgggcgctggaccggttcggtgaggtcctggccgaactg
cgcgcggagaagggctag

DBGET integrated database retrieval system