KEGG   Nocardiopsis gilva: CDO52_22140Help
Entry
CDO52_22140       CDS       T05022                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ngv00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CDO52_22140
Enzymes [BR:ngv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CDO52_22140
DNA repair and recombination proteins [BR:ngv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CDO52_22140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ASU85131
UniProt: A0A223SAH2
LinkDB All DBs
Position
complement(4976543..4977454)
Genome map
AA seq 303 aa AA seqDB search
MGAQTIHVAGHDIDVSKLDKEFYPDDHLTKGDVLDHYRAVADVMLPHLADRPLTMRRYPD
GIGADGFYQKEASDYFPDWLRVVEVPQRGDGSVSHVVCDDAAMLVYLANQATIEFHVGLS
TVDKLDCPDRLAIDIDPPPGVSVATLREVARRLRTLYRELGLTPFVQATGGRGYHVVAPL
DRSADFRFVRDLAVGIADHLADGDPGLLTTEQRKERRGDRIFLDVNRNAYGQTFITPYSL
RARPGATVATPLDWHELGRSTPNGHTHATIRNRLGHKSDPWATIDEQAATPATARDRLAA
LAD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggggcacagaccatccacgtcgccggccacgacatcgacgtgtccaaactggacaag
gagttctacccggacgatcacctcaccaagggcgacgtgctcgaccactaccgggccgtc
gccgatgtcatgcttccgcacctcgccgaccgtccgctgaccatgcgccgctacccggac
gggatcggcgccgacggcttctaccagaaggaggcctcggactactttcccgattggctg
cgcgtcgtcgaggtgccccagcgcggtgacggttcggtgagtcacgtggtgtgcgacgac
gccgccatgctggtgtacctggccaaccaggcaacgatcgagttccacgtcgggttgtcc
accgtagacaagctggactgccccgaccggctggcgatcgacatcgacccgccaccaggc
gtgtcggtggccacgctgcgcgaggtcgcgcgccgtctgcgcaccctgtaccgcgagctc
gggctgacccccttcgtgcaggccaccggcgggcgcggctaccacgtggtcgcgccgctg
gaccgctcggccgacttccggttcgtccgcgacttggccgtcggcatcgcggaccacctc
gccgatggcgaccccggcttgctgaccaccgagcagcgcaaggagcgccgcggcgaccgg
atctttctcgacgtcaaccgcaacgcctacggccagacgtttatcacgccgtactcgcta
cgcgctcgccccggcgcaacggtggccaccccactggactggcacgaactcggccgctcc
accccgaacggccacacccatgcgacgatccgcaaccgcctcgggcacaaatccgacccc
tgggcgactatcgacgagcaggccgccacaccggccaccgctcgcgatcggctggcggct
ctcgcggattga

DBGET integrated database retrieval system