KEGG   Nocardiopsis gilva: CDO52_22145Help
Entry
CDO52_22145       CDS       T05022                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
ngv  Nocardiopsis gilva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ASU85132
UniProt: A0A223SAH3
LinkDB All DBs
Position
complement(4977456..4978409)
Genome map
AA seq 317 aa AA seqDB search
MTGWRQPMLATLTERRFSDPNWLFERKFDGMRALSVRDDDSKDGAPQLWSRNEKRIDDSY
PELVDALAERGGSRFVADGEIVAFDGEQTSFARLQARIHLTDPERIAATGVAAYYYLFDL
LSHDGEDLTGLPLRKRKRILRDVFDFRDPLRFAPHRNTDGEAYYREACERGWEGLIAKRA
DAPYRGGRSTDWLKFKCVRDQEFVVGGFTDPQRSRVGFGALLVGYHDGSGRFRYAGKVGT
GYDNTTLRSLRERMDGMTRRESPFADAVRERGAHWIHPDLVVQVGFTEWTTDARLRHPRY
LGMRTDKSAADVVRETS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaccggctggcggcaacccatgctcgcgacgctcaccgagcggcggttctccgatccg
aactggctgttcgagcgcaagttcgacggcatgcgcgcactgtccgtccgggacgatgac
agcaaggatggcgccccgcagctgtggtcgcgcaacgagaagcgcatcgacgacagctac
ccggagctggtcgacgcgctcgccgagcgtggcggctcccggttcgtcgccgacggggag
atcgtcgcgttcgacggtgagcagacgagcttcgcccggctgcaggcccgtatccacctg
acggaccctgagcgcatcgcggccaccggggtggccgcctactactacctgttcgacctg
ctgtcccacgacggcgaggatctgactgggctgccgctgcggaaacgcaagcggatcctg
cgggacgtgttcgatttccgcgatccgttacggttcgccccgcaccgcaacaccgatggt
gaggcctactaccgggaggcgtgcgagcgtggctgggagggcctgatcgccaagcgcgcg
gacgcaccgtatcgcggcggacggtcgaccgactggctgaagttcaagtgcgtgcgtgac
caggagttcgtggtcggcggcttcaccgacccgcagcgctcgcgcgtcgggttcggcgcg
ctgctcgtcggttaccacgacgggtccggccggttccgctacgcgggcaaggtcggcacc
ggctacgacaacacgaccctgcgttcgctgcgcgaacggatggacggcatgacccgccgg
gagagccccttcgccgacgcggtgcgggagcggggcgcgcattggatccacccggacctg
gtggtgcaggtcggtttcactgagtggaccaccgacgcccggctgcgccacccgcgctac
ctcgggatgcgcaccgacaagtcggcggccgacgtcgtgagggagacaagctga

DBGET integrated database retrieval system