KEGG   Nocardiopsis gilva: CDO52_22330Help
Entry
CDO52_22330       CDS       T05022                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00473  D-Alanine metabolism
ngv00550  Peptidoglycan biosynthesis
ngv01100  Metabolic pathways
ngv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CDO52_22330
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CDO52_22330
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CDO52_22330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ngv01011]
    CDO52_22330
Enzymes [BR:ngv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CDO52_22330
Peptidoglycan biosynthesis and degradation proteins [BR:ngv01011]
 Precursor biosynthesis
  Amino acid ligase
   CDO52_22330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: ASU85163
UniProt: A0A223SAS0
LinkDB All DBs
Position
complement(5020589..5021704)
Genome map
AA seq 371 aa AA seqDB search
MAEQQKIRVAVVFGGRSSEHEISCVTAGSVLSVIDTDRYEIVPIGITRDGNWVLTSGASE
QLAIRDGRLPSVDEGGAALALPFDSATDLMVVEPDRVPSRIGEVDVVLPLLHGPFGEDGT
IQGLFEMMGARYAGAGVFASAASMDKIFMKALLTGNGIRTGAYVPITEREWQRERKRVLD
DIAELGGTLFVKPARAGSSVGISKVADAADTDAVIAAIEAAREHDPKVIVEAAISGREVE
CGVLESLDGGLPDVSLPAEIHVADGFDFYDFEAKYLSTSSLTIPAELPEQVIADIRALAA
RTFEVMGCEGLARVDFFYGDDGEIYVNEINTMPGFTPTSAFPQMWAATGVDYPALVDRLI
QTALLRQPGLR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcagcaaaagattcgggtcgccgtggttttcggcgggcgcagttccgagcac
gagatctcctgtgtcacggcgggcagtgtgctctccgtcatcgacaccgaccgctacgag
atcgtgcccatcgggatcacccgcgacggcaactgggtgctgacctccggcgcgagcgag
cagctggccatccgcgacggtcggctgcccagcgtcgatgagggaggagccgccctcgcg
ctgcccttcgactccgccaccgacctgatggtcgtcgagccggaccgggtgccgtcgcgc
atcggcgaggtcgacgtcgtcctgccgctgctgcacggtccgttcggcgaggacggcacc
atccagggcctgttcgagatgatgggcgcccgctacgccggtgccggggtcttcgccagc
gccgcctccatggacaagatcttcatgaaggcgctgctcaccgggaacggcattcgcacc
ggcgcctatgtgccgatcaccgagcgcgagtggcagcgtgagcgcaagcgcgtccttgac
gacatcgcggagctcggcggcacgctcttcgtcaagccggcccgcgccgggagcagcgtc
ggcatcagcaaggtggccgacgccgccgacaccgacgccgtcatcgccgcaatcgaggcg
gcgcgcgagcacgacccgaaggtcatcgtcgaggccgcgatctccggccgggaggtcgag
tgcggcgtgctggaatcgctggacggcggcctgcccgatgtgtcgctgcccgccgagatc
cacgtcgccgacggcttcgacttctacgacttcgaggccaagtacctctccacgagcagc
ctcaccatccccgccgagctgccggaacaggtcatcgccgacatccgcgcactggccgcg
cgcacgttcgaggtcatgggctgcgaggggctggctcgcgtcgacttcttctacggcgac
gacggcgagatctacgtcaacgagatcaacaccatgccgggattcaccccgacgtcggcc
ttcccccagatgtgggcggcgacgggcgtggactaccccgccctggtcgaccgacttatc
cagaccgcgctgctccgccagccgggcctgcgctag

DBGET integrated database retrieval system