KEGG   Nocardiopsis gilva: CDO52_23365Help
Entry
CDO52_23365       CDS       T05022                                 

Definition
(GenBank) beta-ketoacyl synthase
Organism
ngv  Nocardiopsis gilva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C KAsynt_C_assoc adh_short PP-binding Thiolase_N Epimerase Docking Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-ProteinID: ASU85343
UniProt: A0A223SBA8
LinkDB All DBs
Position
complement(5312763..5323619)
Genome map
AA seq 3618 aa AA seqDB search
MTNANDDKLRDYLKRATADLQQTRRRLREVEARDHEPIAIVGMACRYPGGATTPEDLWRL
VDEGQDVIAGFPTDRGWDVDDLYDPVPGTPGKTYAREGGFLYDAAEFDADFFSISPREAK
ESDPQQRLLLETSWEAFERAGIDPTQLKGSPTGVFAGLVYHDYAASTTRGAVVSGRVSYT
LGLEGPAVTVDTACSSSLVALHLAAQSLRRGETSLALAGGVTVIATPETFVWFSEQRGLS
PDGRCRAFDAAADGTGWGEGAGMLLLERLSDAKKNGHPVLALLRGSAINQDGASNGLTAP
NGPSQMRVIEQALADAQISAEHVDVVEAHGTGTTLGDPIEAQALLATYGKKRPEDGRPLW
LGSIKSNFGHTQAAAGVAGVIKMVMAMRNGRLPKTLHVDEPSPQVEWTAGAVELLAEPVE
WPENGHPRRAGVSSFGASGTNSHVILEQAPAAEEGEAAETAADTGEDGATASAPTPGPAL
PVVPWMLSARTPQALQAQAAKLGERADLTQEADPADVGHALLTTRAAFDHRAVVVGGDRA
SLTEGLAALAGGEPAPNLVRGTALSDPRMVFVFPGQGSQWVGMAVDLLDSSPAFAERMAE
CARALKAYVDWDLIDVVRGEPGAPTFDAVDVVQPVLWAVMVSLAEVWRSFGVRPDAVVGH
SQGEIAAACVAGALTLDDGAKVVALRSQIIAEKLAGKGGMVSVSAPIARVRELVEGWDGR
IQIAVENGPGTVVVCGEVETLDGFLAQMEEEGIRARRVKVDYASHSVFVEEIRDDLLKAL
EGVRPQPCDTAFYSTVTGGLLDTSELGAEYWYTNLRSTVRFEEVVRGLLEKGFGAFIESS
AHPVLTMSIDESVEAAGAAAATIGSLRRDEGGLDQFALSLAEAHVNGVPVDWDPAFAGRS
GARVDLPTYAFQREHYWLDSVGGQGGDVRSVGLGSADHPLLGAAVSLAGSDSSVLTGRLA
VRSQPWLADHRVGETILFPGIGFVELAIRAGDEVGCGALEELTLEAPLVLPERGGVSLQV
VVGGPDASGSRTVDVYSRPDDEDAVDVPWTRHATGLVTSDGSGHGGAQLVEWPPADATPL
AVDGAYERLAENGYGYGPVFQGLRAAWQRGDELFAEVELADSAQNDAARFGLHPALLDAA
MHVIALTGSTGGGEVMLPFAWSGVDLHAAGATALRVRVDRTRDDVLKLDIADPTGAPVVS
VESLALRSISEAQLSAAQSTFHDALFQVEWPTLPVTAAGGDPVAHVAWDAIEDGDEIPSL
VLLPSGGGSTPEEVRTATHRVLGVLQEWLAEERFADARLVVATRGAVAVDPEERVTDLAG
AAMWGLVRSAQTENPGRVVLVDLDANDETTDLADVLPGIAAAGESQIAVRRSALHTARLT
RVPVSAEAADGTGPSDAFGTNGTVLLTGATGMIGSQVAKHLATEHGVRRLLLTSRRGMDA
PGAADLKEELAGLGAEVEIAACDAADRDALAALLDGIPDEHPLTGVVHAAGVLDDGVIAS
LTPERIDAVMRPKVDAAWNLHELTQDLDLSAFVLFSSAAGVIGSPGQGNYAAANAFLDAL
IARRRADGLPGQSLAWGLWAQSSEMTGQLDDTDKSRISQGGVVPLTCDEGMALFGTATRL
ATPSVLVPMRLDLKALSSGGAVADLFRGLVRTPARRTANRAAGAASLQERLARIPEADRE
AAVLEIVLKQVASVVGLSSAASVDPQRAFADLGFDSLMAVELRNGLKDEIGLRLPATLIF
DYPTPVRVAQHILTEVSGKVDEAVPSRPVSAQLDDDPIVIVGMSCRFPGGVASPEDLWRL
VEEGRDAVSAFPEDRGWGADLYDPEPGAPGKVYTREGGFLYDAADFDPAFFNISPNEALY
MDPQQRLLLEASWEAFESAGIDPGALQGSPTGVFAGMMYHDYAANAATGGIASGRVSYTF
GLEGPAVTVDTACSSSLVALHWAIQSLRSGECSLALAGGVAVMATPEVFVEFASQRGLSP
DGRCKSFAGSADGAGWSEGVGMLVVERLSDAKKNGHAVLAVVRGSAVNQDGASNGLTAPN
GPSQRRVIRQALAGAGLSAGEVDVVEAHGTGTTLGDPIEAQALMATYGQERPESGEPLWL
GSIKSNIGHAQAAAGVAGAIKMIEAIRRGQLPKTLHVDEPTPQVDWSEGAVELLTEQREW
PENGHPRRAGISSFGISGTNAHVILEQAPSEHASAARDETPEGEAAGDVVSGEEAPLPVT
PWVLSGRSAKALRAQAERLKAFVSERDELTGIDVAYSLATTRVPLEHRAAVVGADREELL
RGLDTVISGETRPNVVEGTARDGKIAFLFSGQGAQRLGMGRELYAAFPVFAEAFDAVVAG
LDAHLDRPLKEIVWAEEGSDAAELLNQTAYTQTALFAIEVALFRLVESWGIRPDFLAGHS
IGELAAAHVAGVLSLEDACALVAARGRLMQKLPSGGAMVAIQTTEEAVTSELAGLEAKVS
IAAINGPSSVVVSGEEDAVFQIAERFKEQGRKTSRLTVSHAFHSPLMEPMLDEFRAVAER
LTYGTPTIPIVSNLTGAPAPSVDLGDIGVKNGAETPISPRSTVDVGSAEYWVRHVREAVR
FADGVRALESEGVTTFLELGPDGVLTGMARGCVESDSAVLAPAVRKNRPEAVALVTALGT
LHVSGVAVDWTQVFAGTGAKRVDLPTYAFQHERYWMDSVGGKGGDVRSVGLGSADHPLLG
AAVRLAGSDGVVLSGRLSVGTQPWLADHTVAGSVLFPGTGFVELAVRAGDEVGCGALEEL
TLEAPLVLPERGGVALQVVVGEPGESGSRSINIYSHGEEESAEEPWTRHATGVIGSSTGT
PAFDLVAWPPRGAEPIDLDGFYAGLAADGLDYGPLFRGLRAAWRAGDEIFAEVALPEEAQ
DEAAQFGLHPAALDAALHAVALTGSTEGVVLPFAWTGVELHAAGASSLRVRVCPARDGEV
ELQIADPAGGAAATVESLVLRPISPEQLAAARTAVHDSLFRLDWSPVRVGAAEAASWAVL
GSTGTELVEALGDKTRNIDDLGAARDTDVVLLPCDGGGSEPEAVRAVTHQVLGVLQSWLA
EDRFADARLVVVTRGAVAVGADEDATDLAGAALWGLVRSAQAENPERIVIVDLDEGADTA
QRLAAVLASGEPQVAVRGSAILTPRLARVPVGQEAPDGVATGTVLVTGATGTLGALVAKH
LVAERGVRRLLLTSRRGMDAPGAADLKEELAGLGAEVEIAACDAADRDALAALLDGIPDE
HPLTGVVHAAGVLDDGVIASLTPERIDAVMRPKVDAAWNLHELTQDLDLSAFVLFSSAAG
VIGSPGQGNYAAANAFLDALAAHRRAQGRVGHSLAWGLWASAAGMAGDLSDADVQRLSRS
GVDALAVDEGLALFDTATGLAEPVLLPMRLNVSALAASAGDVSAIPGVFRGLVRTPARRT
AEAGSGAAAATFKQRLAGLSRDERGTVLLDLVRGQAAAILGHSGPEAVEPDWAFSDLGFD
SLTAVEFRNQINAATGLRLPATLIFDYPSSQVLADHLVAELAPQDDGDSGAGSSEDRIRV
ALQAIPLDRLREAGLMDSLLELAGITDVDGPQAADEGDGDGADSIDDIDEMDAESLISMV
LDGSDDSDDSDDDATREA
NT seq 10857 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgccaacgacgacaagcttcgcgactatctcaagcgggccacggccgacctc
cagcagacccggcgtcgcctccgtgaggtcgaggcccgcgaccatgagccgatcgcgatc
gtgggcatggcgtgccgctaccccgggggcgccaccacccccgaggacctgtggcggctg
gtggacgaggggcaggacgtcatcgcggggttccccaccgaccgcggctgggacgtcgac
gacctctacgacccggttccgggaaccccgggcaagacctacgcgcgcgagggcgggttc
ctctacgacgcggcggagttcgacgccgacttcttcagcatcagcccgcgcgaggccaaa
gagagcgacccgcagcagcggctgctcctggagacctcctgggaggccttcgaacgggcc
gggatcgaccccacccaactcaagggcagccccaccggcgtgttcgccgggctcgtctac
cacgactacgcggccagcaccacgcgcggcgccgtcgtctccgggcgcgtctcctacacc
ctcggcctggagggtccggcggtcacggtcgacacggcgtgctcgtcatcgctggtcgcc
ctgcacttggcggcgcagtcgctgcgtcggggcgagacgtcgctggcgctggccgggggc
gtcaccgtcatcgccacccccgagaccttcgtgtggttcagcgagcagcgcggactctcc
ccggacgggcggtgcagggccttcgacgcggcggccgacggcaccggctggggcgagggc
gccgggatgctgctgctggagcggctgtccgacgccaagaagaacggccacccggtgctc
gcgcttctgcgcggcagcgcgatcaaccaggacggcgccagcaacggcctgaccgccccc
aacggcccctcccagatgcgggtgatcgagcaggcgctggccgatgcccagatctcggcc
gaacacgtcgacgtggtggaggcgcacggcaccgggacgacgctcggcgacccgatcgag
gcgcaggcgctgctggccacctacggcaagaagcgccccgaggacggccgcccgttgtgg
ctggggtccatcaagtcgaacttcggtcacacgcaggcggcggcgggcgtggccggtgtg
atcaagatggtcatggccatgcgcaacggccgactgcccaagacgctgcacgtggacgag
ccgtcgccgcaggtcgaatggacggccggggcggtcgagctgctggccgagccggtcgag
tggccggagaacgggcacccgcgccgcgccggtgtctcgtccttcggcgccagcggtacc
aactcccacgtcatcctggagcaggcgcccgcggccgaggagggcgaggcggccgagacc
gccgctgacaccggcgaggacggcgccaccgcgtcggcgccgacccccggcccggccctg
ccggtcgttccgtggatgctctccgcccggaccccgcaagcgctgcaggcgcaggcggcc
aagctcggcgagcgcgcggacctgacgcaggaggccgacccggccgacgtcgggcacgcg
ctgctcacgacgcgtgcggcgttcgaccaccgcgcggtggtcgtcggcggcgatcgcgcg
tccctcaccgaaggcctggccgccctggccggaggggaacccgcccccaacctggtgcgc
ggtacggcgctgagtgacccgcgcatggtgttcgtgttccccggtcagggctcgcagtgg
gtcggcatggccgtcgacctcctcgactcctccccggcattcgctgagcggatggccgag
tgtgcccgcgccctcaaggcctacgtggactgggacctgatcgacgtggtgcggggcgag
ccgggcgcaccgacgttcgacgccgtcgacgtcgtgcagccggtgctgtgggccgtgatg
gtctcgctggccgaggtgtggcggtccttcggggtccggcccgacgcggtcgtcggccac
tcccagggcgagatcgcggccgcctgcgtcgccggtgccctcaccctcgacgacggtgcc
aaggtcgtggccctgcgcagccagatcatcgccgagaagctcgcgggcaagggcggcatg
gtctcggtctccgcgccgatcgcgcgcgtgcgcgagctggtcgagggctgggacgggcgc
atccagatcgccgtggagaacggccccgggacggtcgtggtgtgcggcgaggtcgaaacg
ctcgacgggttcctcgcgcagatggaggaggaagggatccgcgcgcgccgcgtgaaggtg
gactacgcctcgcactcggtgttcgtggaggagatccgcgacgacctgctcaaggcgctg
gagggggtgcgcccccagccctgcgacaccgccttctactcgacggtgaccggcgggctg
ctggacacctccgagctgggcgccgagtactggtacaccaacctccgctcgaccgtgcgc
ttcgaggaagtcgtccggggcctgttggagaagggcttcggcgccttcatcgagtcgagt
gcgcacccggtgctgaccatgagcatcgacgagtccgtggaggccgccggggcggcggca
gcgaccatcggatcgctgcgccgcgacgagggcggcctggaccagttcgccctctccctc
gctgaggcgcacgtcaacggtgtgccggtggactgggacccggcctttgctggtcgctcc
ggtgcgcgcgtggacctgccgacctacgccttccagcgcgagcactactggctcgactcg
gtcggcggccagggcggcgacgtccgatcggtcggcctgggctcggcggaccacccgctg
ctcggcgcggcggtcagcctcgccggatccgacagctcggtgctgaccggccgactcgcg
gtgcggtcgcagccatggctggccgaccaccgggtcggggagaccatcctgttcccggga
atcggcttcgtggaactggcgatccgcgccggtgacgaggtcggctgcggtgcgctggag
gagctgaccctggaggcgccgctggtgctgcccgagcgcgggggtgtctcgctccaggtc
gtggtcggcggaccggacgcgtcgggcagtcggaccgtcgacgtgtactcgcgtcccgac
gacgaggacgcggtggacgtgccgtggacgcggcacgccactggactggtgacctcggac
ggaagcgggcacggcggcgcgcagctggtcgagtggccgccggccgacgccaccccgctc
gccgttgacggcgcctatgagcggctggcggagaacgggtatggctatgggccggtgttc
caggggctgcgggccgcctggcagcgcggcgacgaactgttcgccgaggtcgagctggcc
gattcggcgcagaacgacgcggcgaggttcggtctgcacccggccctcctcgacgccgcg
atgcacgtcatcgcgctgaccgggagcaccgggggcggcgaggtcatgctgccgttcgcc
tggtcgggcgtcgacctgcacgcggccggtgcgaccgccctgcgggtccgcgtcgaccgg
acccgcgacgacgtgctgaaactggacatcgctgacccgaccggcgcccccgtggtgtcg
gtggagtcgctggcgctgcggtcgatctccgaggcgcagctgagcgccgcccagtcgacc
ttccacgacgcgctcttccaggtggagtggcccacgctgccggtcacagcggccggtggc
gacccggtcgcgcacgttgcctgggacgcgatcgaggacggggacgagatccccagcctc
gtcctgctcccgagcggcggcggatccacacccgaggaggtgcggacggcgacgcatcgg
gtgctgggcgtgctgcaggagtggctcgcagaggaacggttcgccgacgcgcgcctggtc
gtggcgacgcgtggcgccgtggcggtggacccggaggaacgggtcaccgacctggccggt
gcggctatgtggggtctggtgcgctccgcacagaccgagaacccgggccgggtcgtgctc
gtggacctggacgcgaacgacgagacgaccgacctcgccgacgtcctcccggggatcgcc
gcggcgggagagtcgcagatcgcggtgcgcagatcggccctgcacaccgcccgcctgacc
cgcgtcccggtttcggcagaggctgcagacggcactgggcccagcgacgcgttcggcacc
aacgggacggtgttgctcaccggagccaccggcatgatcggatcgcaggttgccaagcac
ctggccaccgagcacggtgtgcggcgcctgctgctgaccagccgtcggggcatggacgcg
ccgggtgccgctgacctgaaggaggagctggcggggctgggcgccgaggtggagatcgcc
gcctgcgacgcggccgaccgtgacgcgctggcggcgcttctcgacggcatcccggacgag
cacccgctcaccggcgtcgtgcacgcggccggtgtactggacgacggcgtgatcgcttca
ctcaccccggagcggatcgacgcggttatgcgtcccaaggtggatgcggcgtggaacctg
cacgagctgacgcaggacctcgacctgtcggcgttcgtcctgttctcgtcggcggcgggt
gtcatcgggtcgccggggcagggcaactatgccgccgccaacgccttcctcgacgcgctc
atcgcccgccgccgcgccgacgggctcccgggccagtcgctggcatggggtctgtgggcg
cagagcagcgagatgaccgggcagctggacgacaccgacaagtcccgcatctcgcagggg
ggcgtggtgcccctgacctgcgacgagggcatggcgctcttcggcaccgcgacgcgtctg
gccacgccgtccgtgcttgttccgatgcggctggacctcaaggccctgagtagcggcggc
gcggtggcggacctgttccgcggtctggtgcgcacgcccgcgcggcggaccgcgaaccgc
gcggctggtgccgcctcgctgcaggagcgcctggccaggatcccggaggccgaccgcgaa
gccgccgtgctggagattgtgctcaagcaggtcgcctcggtcgtcggcctcagctcggcc
gcgtccgtcgacccgcagcgggccttcgccgacctcggcttcgactcgctgatggcggtg
gagctgcgcaacggactcaaggacgagatcgggctgcgcctgcccgccacgctgatcttc
gactacccgacgccggtgcgcgtcgcccagcacatcctcaccgaggtctcggggaaggtc
gacgaggccgtcccgagccgaccggtctccgcgcagctcgacgacgacccgatcgtcatc
gtcggcatgagctgccgcttccccggcggtgtcgcctcacccgaggacctgtggcggctg
gtcgaggaaggccgggacgccgtctccgcgttcccggaggaccgcggttggggtgccgac
ctctacgaccccgaaccgggcgcgccgggcaaggtctacacacgcgagggcggtttcctc
tacgacgcggccgacttcgaccccgcgttcttcaacatcagcccgaacgaggcgctgtac
atggacccgcagcagcggctgctgctggaggcgtcgtgggaggcgttcgagagcgcgggc
atcgacccgggcgcgctccagggcagcccaaccggtgtgttcgccgggatgatgtaccac
gactacgcagccaacgccgcgaccggcggcatcgcctccggccgcgtctcctacaccttc
gggttggaggggccggcggtcacggtcgacaccgcgtgctcgtcctcgctggtcgcgctg
cactgggcgatccagtcgctgcggtcgggcgagtgctcgctggcgctggccgggggcgtg
gcggtcatggcgacgcccgaggtcttcgtcgagttcgccagccagcggggcctgtcgccg
gacggccggtgcaagtcgttcgccggttcggcggacggggccgggtggtccgaaggtgtg
ggcatgctcgtcgtggagcggctgagtgatgcgaagaagaatggccacgcggtcctggcg
gtcgtgcgcggcagcgcggtcaaccaggacggcgcgtccaacggactgaccgccccgaac
ggtccctcacagaggcgcgtgatccggcaggcgcttgccggtgctgggctgtctgcgggc
gaggtcgatgtggtggaggcgcacgggaccgggacgacgctgggcgacccgatcgaggcg
caggcgctgatggcgacctacgggcaggaacggccggagagcggcgagccgctgtggctc
gggtcgatcaagtcgaacatcgggcacgcgcaggccgcggcgggcgtggccggggccatc
aagatgatcgaggccatccggcgcgggcagctgccgaagacgctgcatgtcgatgagccg
acgccgcaggtggactggtctgagggcgcggtggagctgctcaccgagcagcgggagtgg
ccggagaacggccacccgcggcgtgccgggatctcgtcgttcgggatcagcggcaccaac
gcccacgtcatcctggagcaggcgccgagcgagcacgcgtcggcggcccgcgacgagacg
ccggagggcgaggcggccggagatgtcgtatcgggcgaggaggcgcccctgccggtgacg
ccgtgggtgctgtcgggccggagcgcgaaggcactgcgcgcccaggccgagcggctgaag
gcgttcgtgtcggaacgggacgagctcaccggcatcgacgtcgcgtactcactggctacg
acgcgcgtgccgttggagcaccgcgcggcggtcgtcggcgccgaccgcgaggagctgctg
cgcggcctggacacggtcatctccggtgagacccgccccaacgtcgtcgaggggacggcg
cgagacggcaagatcgccttcctgttctccggtcagggcgcgcagcgtctgggtatgggt
cgggagctgtacgcggccttcccggtgttcgctgaggcgttcgatgccgtggtggcgggg
ctggacgcacaccttgaccgtccgctgaaggagatcgtctgggccgaggaggggtcggat
gcggccgagctgctgaaccagacggcttatacccagacggcgctgttcgcgatcgaggtg
gcgctgttccggctggtcgagtcgtgggggatccggccggatttcctggctggtcactcg
atcggtgagctggccgccgcccacgtagcgggcgtcctgtccctggaggacgcgtgtgcg
ctcgtcgcggcgcgcggtcggttgatgcagaagcttccgtccgggggcgcgatggtcgcg
atccagacgacagaagaggcggtcacatcggagctggcgggcctggaagccaaggtcagc
atcgcggcgatcaacggcccgtcctcggtcgtggtgtccggcgaggaagacgccgttttc
cagatcgccgagcgcttcaaggagcagggtcgcaagaccagccgtctgacggtctcgcac
gcgttccactccccgctgatggagccgatgctggacgagttccgtgcggtcgccgagcgg
ctcacctacgggacccccaccatcccgatcgtctccaacctgaccggcgccccggcccct
tccgttgatctcggggatatcggggtaaaaaacggcgctgagaccccaatatctccgaga
tcaacggtggatgtgggctcggcggagtattgggtgcgacacgtccgcgaggctgtgcgg
ttcgccgacggcgtccgcgccctggagtcggaaggcgtcactaccttcctcgaactcggg
ccggacggcgtcctcaccggcatggcacgcggctgcgtcgaatccgacagcgcggtactg
gctcctgcggttcgcaagaaccgtcccgaggccgtcgcgctggtcaccgcactcggcacc
ctgcacgtcagcggcgtcgccgtcgactggacgcaggtgttcgccgggacgggcgcgaag
cgcgtggacctgcccacctacgccttccagcacgagcggtactggatggattcggtcggc
ggcaagggcggcgatgtccgctcggtcggtctgggttcggccgaccacccgctgctgggt
gcggccgtgcgcctggcagggtccgacggggtggtcctctccgggcggctgtcggtcggc
acacagccgtggctggccgaccacacggtggccgggtcggtgctgttccccggcaccggc
ttcgtggagctggcggtccgcgccggtgacgaggtcggttgcggtgcgctggaggagctg
accctggaggcgccgctggtgctgcccgagcggggcggcgtcgcgctgcaggtcgtggtc
ggcgagccgggcgagtcaggatcgcgctcgatcaacatctactcgcacggcgaagaggag
tcagcggaggagccgtggactcggcacgccaccggtgtcattggctcgtctacgggaacg
cccgcgttcgacctggtggcctggccaccgaggggcgccgagccgatcgacctggacggc
ttttacgccggtctggccgccgatggcctcgactacggcccgctgttccgggggctgcgc
gccgcctggcgcgcgggggacgaaatcttcgccgaggtcgccctgcccgaagaagcgcag
gacgaagccgcccagttcggcctgcaccccgccgcgctcgacgcggcgctgcacgccgtc
gcgctgaccgggagcaccgagggtgtggtactgccgttcgcctggacgggcgttgaactg
cacgcggcaggcgcatcaagcctgcgcgtccgggtgtgcccggcccgcgatggcgaggtg
gagctgcagatcgcggacccggctgggggcgcggcggccaccgtggagtcgcttgtgctg
cggccgatctcccccgagcagctggccgccgcccggacagccgtccacgactcgctgttc
cgtctggactggtcacccgtccgtgtgggcgcggcggaggccgcctcctgggcggtgctc
ggttccacgggtacagagcttgtcgaggctctgggcgacaagacccggaacatcgacgac
ctcggcgccgcacgggacaccgacgttgtactgctgccgtgcgacggcggcggctccgaa
ccggaggccgtccgggcggtgacgcatcaggtcctgggcgtgctgcagtcgtggctggcc
gaggacaggttcgccgacgcgcgcctggtcgtggtgacgcgcggagcggtcgcggtcggc
gcggacgaggacgcgaccgacctggccggggctgcgctctggggtctggtgcgatccgca
caggcggagaaccccgagcggatcgtgatcgtggatctggatgagggagccgacaccgcg
cagcggctggcggcggtcctcgcctccggcgagccgcaggtcgcggtgcgcggatcggcg
atcctcacgccccgactggccagggtgcccgtggggcaggaagcaccggatggcgtcgcc
accggcaccgtgctggtcaccggcgcaaccgggaccctgggtgcgctcgtcgccaagcac
ctcgtcgctgagcgtggggtgcggcgcctgctgctgaccagccgtcggggcatggacgcg
ccgggtgccgctgacctgaaggaggagctggcggggctgggcgccgaggtggagatcgcc
gcctgcgacgcggccgaccgtgacgcgctggcggcgcttctcgacggcatcccggacgag
cacccgctcaccggcgtcgtgcacgcggccggtgtactggacgacggcgtgatcgcttca
ctcaccccggagcggatcgacgcggttatgcgtcccaaggtggatgcggcgtggaacctg
cacgagctgacgcaggacctcgacctgtcggcgttcgtcctgttctcgtcggcggcgggt
gtcatcgggtcgccggggcagggcaactatgccgccgctaacgccttcctcgacgccttg
gccgcccaccggcgggcacagggtcgggtcggccactcgctggcctggggcctgtgggcg
agcgccgccggtatggccggggacctgagcgacgccgacgtgcagcggctgagccgttcc
ggtgtcgacgcgctcgccgtcgacgaggggctggccctgttcgacaccgccaccggactg
gccgagccagtgcttctgcccatgcggttgaacgtcagcgcgctggccgccagcgccggg
gacgtctccgccatcccgggtgtgttccgcggcctggtgcgaacgccagcgcggcgcacc
gccgaggccggatcgggcgcggctgcggccacgttcaagcagcgcctggcggggctgtcg
cgggacgagcgcggcaccgtgctgctggacctcgtccggggccaggcggcggcgatcctg
gggcactccggaccggaggcggtggaaccggactgggccttcagcgacctgggcttcgac
tcgctgacggcggtcgagttccgcaaccagatcaacgcggccacggggctccgcctcccg
gccacgctgatcttcgactaccccagctcccaggtgctggccgaccacctcgtggccgaa
ctggcaccgcaggacgacggtgacagcggcgcggggtccagcgaggaccggattcgcgtg
gcactgcaggcgatcccgcttgaccggctgcgcgaggccgggctgatggacagcctgctc
gaactggccgggatcaccgacgtcgatggcccgcaggctgcggacgagggggacggcgac
ggtgccgactccatcgacgacatcgacgaaatggacgccgagagcctgatcagcatggtg
ctggacggctccgacgattccgatgactccgacgacgacgcgacgcgggaagcgtga

DBGET integrated database retrieval system