KEGG   Nocardiopsis gilva: CDO52_24655Help
Entry
CDO52_24655       CDS       T05022                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00020  Citrate cycle (TCA cycle)
ngv00480  Glutathione metabolism
ngv01100  Metabolic pathways
ngv01110  Biosynthesis of secondary metabolites
ngv01120  Microbial metabolism in diverse environments
ngv01130  Biosynthesis of antibiotics
ngv01200  Carbon metabolism
ngv01210  2-Oxocarboxylic acid metabolism
ngv01230  Biosynthesis of amino acids
Module
ngv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ngv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ngv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDO52_24655
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CDO52_24655
Enzymes [BR:ngv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CDO52_24655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASU85566
UniProt: A0A223SBV8
LinkDB All DBs
Position
complement(5660451..5661668)
Genome map
AA seq 405 aa AA seqDB search
MAKIKVENPVVELDGDEMTRIIWSFIKDRLILPYLDVDLKYYDLGIEERDRTDDQITVDA
ANAIKQYGAGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIICQNVPRL
VPGWTQPIIIGRHAHGDQYKASDFKVPGPGTVTITYTPEDGGEPIEMEVASFPEGGGVAM
GMYNFRKSIEDFARASFGYGLDRGYPVYLSTKNTILKAYDGMFKDVFAEIYEAEYKEKFE
AAGITYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTADG
STVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIFAWTRGLDHRGKLDNTPKVNEFAHALE
DVVVNTVEGGQMTKDLALLVGGEQDWLTTEQFLAALDENLQKRLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaatcaaggttgagaatcccgtagtagagctcgacggcgacgagatgacccgg
atcatctggtccttcatcaaggaccggctgatcctgccctacctggacgtcgacctcaag
tactacgacctcggcatcgaggagcgggaccgcaccgacgaccagatcacggtcgacgcg
gccaacgcgatcaagcagtacggcgccggcgtcaagtgcgccaccatcacccccgacgag
gcccgcgtcgaggagttcggcctgaagaagatgtggcggtcgcccaacggcaccatccgc
aacatcctcggcggcgtcgtcttccgcgagccgatcatctgccagaacgttccgcgcctg
gtcccgggctggacccagccgatcatcatcggccgccacgcccacggcgaccagtacaag
gccagcgacttcaaggtgcccggtcccggcacggtgaccatcacctacacgcccgaggac
ggcggcgagcccatcgagatggaggtcgccagcttccccgagggcggcggcgtcgccatg
ggcatgtacaacttccgcaagtccatcgaggacttcgcccgggccagcttcggctacggc
ctggaccgcggctacccggtctacctctccaccaagaacacgatcctcaaggcctacgac
ggcatgttcaaggacgtgttcgcggagatctacgaggccgagtacaaggagaagttcgag
gcggccgggatcacctacgagcaccggctgatcgacgacatggtcgccgccgcgctgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgatgtgcagtccgacacg
gtcgcgcagggcttcggctccctcggcctgatgacgtcggtgctgcgcacggccgacggc
agcaccgtcgaggccgaggccgcgcacggcacggtcacccggcactaccgccagcaccag
gccggcaagcccacctcgaccaacccgatcgcgtccatcttcgcctggacccgcggcctg
gaccaccggggcaagctcgacaacaccccgaaggtcaacgagttcgcccacgcgcttgag
gacgtcgtcgtcaataccgtcgagggcggccagatgaccaaggacctcgcgctgctggtc
ggcggcgagcaggactggctcaccaccgagcagttcctcgccgcgctggacgagaacctg
cagaagcgcctcgcctga

DBGET integrated database retrieval system