KEGG   Nitrobacter hamburgensis: Nham_0039Help
Entry
Nham_0039         CDS       T00348                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Nham_0039
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nha02000]
    Nham_0039
Enzymes [BR:nha01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Nham_0039
Transporters [BR:nha02000]
 Other Transporters
  Pores ion channels [TC:1]
   Nham_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: ABE60940
UniProt: Q1QS57
LinkDB All DBs
Position
43662..44258
Genome map
AA seq 198 aa AA seqDB search
MMKLYWSPRSRSFTALWLLEETGQPYERVLTDISTGAQKTPEFLAINPMGKVPALTDGNA
ATAEAAAICAYVAERFPDAKLAPPLGDARRAKYLQWLFFGPSCIEPAMIQIFTKLEVPSS
TAAWGNATQVFDVLDKALEKGPWILGSDFSAADIVIGSALYYAVRQFKMVPPRPTFDRYI
DACMARAAFQRAETIAAG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactctactggtcgccgcgctcgcgttcgttcacagcgctctggctgctggag
gaaaccgggcagccctacgagcgggtcctgaccgacatctccaccggcgcgcagaagacg
ccggagttcctcgccatcaatccgatgggcaaggtgcccgcgctgaccgacggcaatgcc
gcgaccgccgaggcggcggcgatctgcgcctacgtcgccgagcgttttccggatgcgaag
ctggccccgccgctcggcgatgcgcgccgggcgaaatatctgcaatggctgttcttcgga
ccgagttgcatcgaaccggcgatgatccagattttcaccaagctcgaggtgccatcgagc
acggcagcgtggggcaacgccacacaggtgttcgacgtgctcgacaaggcgctggaaaag
ggaccgtggattctcggcagcgacttttcagccgccgatatcgtaatcgggtcagcgctt
tactatgccgtgcggcaattcaagatggtgccgccgcgcccaaccttcgaccgctacatc
gacgcctgcatggcgcgggcggcgtttcaacgcgcggagacaatcgcagcgggttag

DBGET integrated database retrieval system