KEGG   Nitrobacter hamburgensis: Nham_0995Help
Entry
Nham_0995         CDS       T00348                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00500  Starch and sucrose metabolism
nha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nham_0995
Enzymes [BR:nha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Nham_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ABE61845
UniProt: Q1QPK2
LinkDB All DBs
Position
complement(1102382..1104784)
Genome map
AA seq 800 aa AA seqDB search
MPLDKPAPGWPGSPARWTSSTKSGVGTALEPGSSVWFTVSHGIVNEVYYPRIDQACIRDL
GLIVADGHGFFSEQKRDTRSTIRLVAEGVPAFVISSTCTQGRYQIEKLVFADPRRDVVLQ
RIALQALVGSTAEYRLYALLAPHLVNKGAGNTAWVDDYKGVPMLFAEGGGTALALGCSPP
FVARSVGFVGVSDGWQDLRQHCELRWHYDVARNGNVALIGEIGLAAGSGSVVLALGFGRT
AAEAALRVRMSLDDDTETKIEEYIAGWRTWQDTLLPLDPAGHSTNHNSYRVSTAVLRAHE
ARSFAGGYIASLSVPWGFAKGDGDLGGYHLVWPRDLVENAGGLLAAGAKKEARQVIAYLQ
GVQEADGHWPQNCWLDGTPYWNGVQLDECAFPILLVDLAFREGALSGAELPGIWPMIEKA
AAFIVGNGPVTGQDRWEEDSGYSPFTLAVVIAALLAAADIADRLSAPGKAAYLRETADVW
NSSIERWTYATGTSLAETIGVDGYYARIAPPEVADAASPLNGFVPIKNRPPQSSCQPASL
VVSPDALALVRFGLRAADDPRILNTVRVIDALLKVDLPAGPCWHRYNGDGYGEHEDGRPF
DGTGTGRCWPLLTGERAHYELAAGHRATAETLLAALEGFASDGHLIPEQIWEAADIPERE
LFLGRPSGSAMPLVWAHAEHVKLLRSLRDGRVFDMPPQPRQRYQVQGQRPRHAIWRFNNK
CRRIPAGRVLRIELSSEAVVHWSADDWRNVRDTATADSGLGIHFADLDTEALKPGGTIVF
TIHWSAQDRWEGVDYRLDVA
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgcccttagacaaacccgcgccggggtggcccggcagcccggcgcggtggacgtcgagt
accaaaagtggcgtcggcacggcgctggagcccggcagtagcgtctggttcaccgtgagc
cacggtatcgtcaacgaggtctactatcctcggatcgaccaggcatgcattcgagattta
ggcctcatcgtcgctgacgggcacgggtttttctcggaacaaaagcgcgacacacgtagt
accattcgattggtcgctgaaggtgtgcccgcttttgtcattagcagcacctgtactcag
ggccgttatcaaatcgagaaattggtgtttgccgatcctcgccgcgacgtcgtgcttcag
cgtatcgcattgcaggcgctcgtgggctcgacggcggaataccggctctatgcactgctc
gcgccgcacctggtcaacaagggagcgggcaataccgcctgggtcgacgactacaagggc
gtgccgatgctctttgccgaaggcggcggaacggcgcttgctctcggttgctcgccgcct
ttcgttgcgagatcggtcggcttcgtcggcgtctcggacggctggcaggatctgcggcag
cattgcgaactgcgctggcattacgatgtcgcgcggaacggcaatgttgccctgatcggc
gaaatcggcctggcggcaggtagcggcagcgttgtgctggccttgggttttggcagaacg
gccgcagaggcagcgctccgcgttcgcatgagtctcgacgacgacaccgagacgaagatc
gaagaatacatcgccggatggcgcacctggcaggatacgcttctgccgctcgaccccgcc
ggccattcaaccaaccacaatagctacagagtgagcaccgccgtactgcgcgcgcatgaa
gcccgctcctttgccggcggctatatcgcgagcctgtccgtgccttggggcttcgccaag
ggggacggcgatctcggcggttatcatctggtctggccgcgcgatctcgtcgagaacgcg
ggcggactgcttgccgcgggcgcgaagaaagaagcacggcaggtcatcgcctatcttcaa
ggagttcaagaggcggacggtcattggccccagaattgctggctcgacggcacgccctat
tggaatggggtgcaacttgacgaatgcgcctttcccatcttgctcgttgaccttgccttt
cgtgagggcgcgttatccggggcggagttgccgggcatctggccgatgatcgagaaagca
gccgcgttcatcgtcggcaacgggcctgttacggggcaggatcggtgggaggaagacagc
ggttattcaccctttacgctcgcggttgtgatcgcggcgcttttggccgctgccgatatt
gccgaccgcctgtccgcgcccgggaaagcggcctatctccgcgaaaccgccgacgtctgg
aacagctcgatcgagcggtggacctatgccaccggcacatcgctcgccgaaacgataggc
gttgacggctattacgctcgcatcgctccgcctgaggtcgccgatgccgcttcgcccctg
aacggattcgttccgatcaagaaccgcccgccccagtcgagctgccagccggcctcgctg
gtggtgagtcccgatgcactggcgctggtgcgcttcgggctgcgcgccgccgacgacccg
cgcattctgaacaccgtgcgcgtaatcgatgccctgctgaaagtcgatttgcctgcgggt
ccgtgctggcatcgctacaatggcgacggctacggtgaacacgaggacggccgaccgttc
gacggcaccggaacggggcgatgctggccccttctgaccggcgaacgcgcgcattacgaa
ctcgcagccggccaccgggccacggccgagaccttgctggcggcgctcgaaggctttgca
agcgacggccatctgatccccgagcagatttgggaagccgcagacattcccgagcgggag
ctttttttgggccgtccttccgggtcggcgatgccgctggtctgggcgcatgcggagcat
gtcaagctcctgcgctcgctcagggacggccgcgtcttcgatatgccgccgcagccccgg
cagcgctatcaggttcaaggccagcgcccgcgccacgccatctggcgcttcaacaacaaa
tgccgccgcataccggcggggcgcgttttacgaatcgagctgtcgtcggaggccgttgtc
cattggagcgcggacgattggcgtaacgtccgtgacacagcgaccgcggacagcggcctc
ggcattcacttcgccgacctcgataccgaagctctcaagcccggcggcaccatcgtcttc
accatccactggtcggcgcaagatcgctgggagggtgtcgactacagacttgacgtcgcc
tga

DBGET integrated database retrieval system