KEGG   Nitrobacter hamburgensis: Nham_1090Help
Entry
Nham_1090         CDS       T00348                                 

Definition
(GenBank) homodimeric glycerol 3-phosphate dehydrogenase (quinone)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00564  Glycerophospholipid metabolism
nha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Nham_1090
Enzymes [BR:nha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Nham_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_oxidored Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABE61938
UniProt: Q1QPA9
LinkDB All DBs
Position
1230688..1232232
Genome map
AA seq 514 aa AA seqDB search
MGQVFDLAIIGGGINGCGIARDAAGRGNSVFLCEMNDLASGTSSLSTKLVHGGLRYLEYY
EFHLVREALIEREILWRIAPHIIRPLRFVLPHHAGLRPTWLLRLGLFLYDHIGGRKLLPP
TRSLDLKRDEVGKPLVPGRYRKGFEYSDCFVDDARLVVLTARDAADRGADIRTRTRAVET
RQTGGLWHLTVEDTLSGERSTIAARVLVNAGGPWVERVLGLGAGVNTRARVRLVQGSHIV
VGKLYDHDRAYIFQNSDGRIVFAIPYQDDFTLIGTTDRDYDGDPARVKASDEEIAYLCAS
VSEYLAKPVKPQDVVWTYAGVRPLYDDGASEAKAATREYVFELDTPGGTPLLSVYGGKIT
THRRLAEEALEKLSAYLKGTKAREGWTAKAPLPGGDMAVPAVAALTAALMRDYPYLAPAH
ANRLAHAYGTRAAKVLGAAKSMADLGRGFGGTLTEREVRYLISDEWACTADDIVWRRSKL
GLRMSAAEIAALDDWFAAQRTQAKRPQQEAGARS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcaggttttcgacctcgctatcatcggcggcggcattaacgggtgcgggatcgcg
cgcgacgcggcgggtcgcggcaattcggtcttcctgtgcgaaatgaacgatctcgccagc
ggcacctcgtcgctgtcgaccaagctcgtacatggcgggctgcgctatctcgaatattat
gaattccatctggttcgcgaggcgctgatcgagcgcgaaatcctctggcggatcgcgccc
cacatcatccgcccgctgcgcttcgtgctgccgcatcacgcgggcttgcggccgacatgg
ctgctgcggctcggcctgttcctttacgatcacatcggcgggcgcaagctgctgccgccg
acgcgctcgctcgaccttaagcgcgacgaggtcggcaagccgctggtccccggccgctac
cgcaagggtttcgaatattcggactgcttcgtcgacgacgcccgcctcgtcgtcctcacc
gcccgcgatgcggccgatcgcggcgcggatatccggacccggacgcgcgcggtcgagacc
cgtcagaccggcggcctctggcacctcacggtcgaggacacgctgagcggagaacgcagc
accatcgcggcgcgggtgctggtcaacgcgggcggcccgtgggtcgaacgggtgctgggg
ctcggcgccggcgtcaacactcgcgcaagagtgcggctggtgcagggttcgcacatcgtg
gtcggaaagctttacgaccacgaccgcgcctacatcttccagaacagcgacggccggatc
gtgttcgcgattccgtatcaggacgatttcaccctgatcggcaccaccgatcgcgattac
gacggcgatcccgccagggtgaaggcctcggacgaggagatcgcctatctctgcgcgtcc
gtcagcgagtatctggcgaagccggtgaagccgcaggacgtggtctggacctatgccggc
gtgcggccgctctacgacgacggcgccagcgaggccaaggccgcgacccgcgaatatgtc
ttcgaactcgatacgcccggcggcacgccgctgctctcggtctacggtggcaagatcacg
acccatcgccggctcgcagaagaagcgctggaaaagctgtcggcctatctgaagggcacc
aaagcgcgcgagggctggaccgcgaaggcgccgctgccgggcggcgacatggccgtgccg
gcggtcgcggcgctgacggcggcgttgatgcgcgactatccttacctcgcgccggcgcac
gcgaaccgtctcgcgcacgcctatggcacccgcgcggccaaggtgctgggcgcggcgaaa
tccatggccgatctcggtcggggattcggcggcacactgaccgagcgcgaggtccgctat
ttaatctccgacgaatgggcctgcactgcggacgacatcgtctggcggcgctccaagctg
ggcttgcggatgtccgcggcggagatcgccgcgctcgacgactggttcgccgcgcagcgg
acgcaagccaagcgtccccagcaggaagcaggagcgcgatcatga

DBGET integrated database retrieval system