KEGG   Nitrobacter hamburgensis: Nham_1543Help
Entry
Nham_1543         CDS       T00348                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
nha  Nitrobacter hamburgensis
Brite
KEGG Orthology (KO) [BR:nha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nha03012]
    Nham_1543
   03029 Mitochondrial biogenesis [BR:nha03029]
    Nham_1543
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nha04147]
    Nham_1543
Translation factors [BR:nha03012]
 Eukaryotic Type
  Elongation factors
   Nham_1543
 Prokaryotic Type
   Nham_1543
Mitochondrial biogenesis [BR:nha03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Nham_1543
Exosome [BR:nha04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Nham_1543
  Exosomal proteins of breast cancer cells
   Nham_1543
  Exosomal proteins of colorectal cancer cells
   Nham_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABE62365
UniProt: Q1QN32
LinkDB All DBs
Position
1757400..1758590
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAEAGGATFTAYDQIDKAPEEKARG
ITISTSHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPAIVVFLNKCDMVDDPELLELVEMEVRELLSKYDFPGDDIPIIKGSALAVLE
NSDPKLGHDAVLELMKAVDAYIPQPERPVDQPFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIRPTQKTTVTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPAGTEMVMPGDNVA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcgaagtttgaacggaacaagccgcattgcaacatcgggacgattggtcac
gttgaccacggcaagacgtctttgacggctgcgatcacgaaggttctggcggaagcgggc
ggagcgacgttcacggcctacgaccagattgacaaggcgccggaagagaaggcgcgcggc
atcacgatttcgacgtcgcatgtcgagtacgagacgccgaaccggcattatgcgcacgtc
gactgcccgggccacgccgactatgtgaagaacatgatcaccggtgcggcgcagatggac
ggcgcgatcctggtggtgtcggcggcggacggcccgatgccgcagacccgcgagcacatt
cttctggcgcgccaggttggcgttccggcgatcgttgtgttcctgaacaagtgcgacatg
gtcgacgatccggagcttttggaactggtggagatggaagtgcgcgagcttctgtcgaag
tacgatttcccgggcgatgacattccgatcatcaagggttcggcgttggcggtgctggag
aactcggatccgaagctcggccatgacgcggtgctggagctgatgaaggcggtcgacgcc
tacattccgcagccggagcgcccggtcgaccaaccgttcctgatgccggtcgaggacgtg
ttctcgatctcgggtcgcggcacggtggtgacggggcgcgtggagcgcggcatcgtcaag
gtcggcgaggaaatcgagatcgtcggcatccgtccgacgcagaagacgacggtgacgggc
gtggagatgttccgcaagctgctggaccagggccaggccggcgacaacatcggcgcgctg
ctgcgcggcaccaagcgtgaggacgtggagcgcggtcaggttctgtgcaagccgggttcg
gtgaagccgcacaccaagttcaaggcggaagcctacatcctgaccaaggaggagggcggt
cgtcacacgccgtttttcaccaactaccgtccgcagttctacttccgcaccacggacgtg
accggcgtggtgcatcttccggccggcaccgagatggtgatgccgggcgacaacgtggcg
atggaagtgcacctgatcgtgccgatcgcgatggaggagaagctgcgcttcgccatccgc
gagggcggacgcaccgtcggagcaggcgtcgttgccagcatcattgaatga

DBGET integrated database retrieval system