KEGG   Nitrobacter hamburgensis: Nham_2101Help
Entry
Nham_2101         CDS       T00348                                 

Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00061  Fatty acid biosynthesis
nha01100  Metabolic pathways
nha01212  Fatty acid metabolism
Module
nha_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Nham_2101
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nha01004]
    Nham_2101
Enzymes [BR:nha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Nham_2101
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     Nham_2101
Lipid biosynthesis proteins [BR:nha01004]
 Fatty acid synthase
  Component type
   Nham_2101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ABE62898
UniProt: Q1QLJ9
LinkDB All DBs
Position
2343884..2344426
Genome map
AA seq 180 aa AA seqDB search
MPGLRSNYDYEDLLACGRGEMFGPSEPKLPLPPMLMFDRITEITEGGGKYGRGLVRTELD
IKPDLWFFRCHFQNDAVMPGCLGLDGLWQMVGFYLVWLGRDRHVRARALGLGDLKFTGQI
LPHVRRVAYTVDIKRVMRSKLVMAIADGTVCADGEVIYRASDLRLGLFKHLPDSPIKPAG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggcttcgcagtaactacgactacgaggacttgctggcctgcggccggggcgaa
atgttcgggccaagcgagccgaaacttccgctaccgccgatgctgatgttcgatcgcatc
acggagatcacggaaggcggcgggaagtacgggcgcggactggtgcgcacggagctcgac
atcaaaccggacctctggttcttccgctgccactttcagaacgacgcggtgatgcccggc
tgccttggcctcgacgggctgtggcagatggtgggattttatctggtctggctcggccgc
gaccggcatgtgcgggcccgcgccctcggcctcggcgatctgaagtttacggggcagatc
ctgccgcacgtccgcagggtcgcctacaccgtggacatcaagcgcgtgatgcgttcgaaa
ctggtgatggcaattgccgatggcacggtatgcgcggacggcgaggtgatctatcgcgcc
agcgaccttcggctcggcctattcaagcaccttcccgactcgccgattaaaccggccggc
tga

DBGET integrated database retrieval system