KEGG   Nitrobacter hamburgensis: Nham_2691Help
Entry
Nham_2691         CDS       T00348                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00620  Pyruvate metabolism
nha00680  Methane metabolism
nha00710  Carbon fixation in photosynthetic organisms
nha01100  Metabolic pathways
nha01120  Microbial metabolism in diverse environments
nha01200  Carbon metabolism
Module
nha_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nham_2691
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nham_2691
   00680 Methane metabolism
    Nham_2691
Enzymes [BR:nha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Nham_2691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABE63470
UniProt: Q1QJX7
LinkDB All DBs
Position
complement(2961587..2964376)
Genome map
AA seq 929 aa AA seqDB search
MSRQMMPLPRAGQPESDAAALDARLRDDIRLLGRILGDTVRDQEGAAVFDLVERIRQTSI
RFHRDEDKPARRELEAILDGMSTDETVLVVRAFSYFSHLANIAEDQNNIRQMRSQSLEGG
ARHEGVLAHTLACAREAGFSGAELQAFFDSALVSPVLTAHPTEVRRKSTIDREMEVAFLL
DRRERMQLTPDEYEVSEEQLRRAVLTLWQTNLLRRTKLTVLDEVANGLSFYDYAFLREVP
RLHCVLEDRLQDASADGASNEMASFLRIGSWIGGDRDGNPFVTADVMRGTLRMQASRVLR
YYLDELHELGRELSLAADLTDVSPELRGLAERSADTSPHRRGEPYRLAVSGIYARLSATA
LKLKADTLRPPYGKAPPYASAAEFSADLDVLHRSLTQNNSEVIARGRLRHLRRAADCFGF
HLACLDLRQNSTVHERTIAELLDAAVPGTSYLALSEEARIVVLLRELRSARPLTSPFITY
SDETLGELAVFHAAAEAHEMFGPGAIPQCIISMSEGVSDLLEVALLLKEADLVDPTGHSA
INIVPLFETIEDLQACAGIMDRLLSLPEYRALVDSRGGLQEVMLGYSDSNKDGGFVTSGW
ELYKAEIGLVEVFERHQVRLRLFHGRGGSVGRGGGPSYDAILAQPGGAVNGQIRITEQGE
IISSKYSNAEVGRNNLEILAAATLEASLLQPRQSAPSLDYLDAMESLSSRAFAAYRNLVY
ETPGFEDYFWASTVINEISTLNIGSRPASRKKTRRIEDLRAIPWVFSWAQCRVMLPGWYG
FGSAVESWIADHPDKGMAFLQELYGEWPFFRMLLSNMDMVLAKSSIAIASRYADLVPDVT
LRETIFGRIRSEWHLTIDTLLAIMGQERLLAGNPLLERSIRNRFPYLDPLNHVQVELLKD
HRAQGGDEQVLRGIQLTINGISAGLRNSG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtcagatgatgccgttaccccgtgcgggtcagccggagtctgacgccgctgcg
ctcgatgcgcggctgcgcgacgatatccggctgctcgggcgcattcttggcgataccgtg
cgcgatcaggaaggggccgccgtgttcgatctggtcgagcgcatccggcagacctcgatc
cgctttcaccgcgacgaggacaagccggcgcggcgtgaactggaagccatcctcgacggc
atgtcgacggacgagaccgtgcttgtcgtccgtgccttcagctatttctcgcacctcgcc
aacattgccgaggatcagaacaacatccgccagatgcgcagccagagcctcgagggcggg
gcacggcacgagggcgtgctggcgcacacgctcgcctgcgcgcgcgaggccgggttcagc
ggcgccgaattgcaggccttcttcgacagtgcgctggtcagcccggtgctgaccgcccac
ccgaccgaggtccgccgcaagagcaccatcgaccgcgaaatggaggttgcgttcctgctc
gaccggcgcgagcggatgcaactcacccctgacgagtacgaggtcagcgaggaacagttg
cgccgcgcggtgctgacgctgtggcagaccaaccttttgcgacggaccaagctcacggtg
ctcgacgaggtcgccaacgggctgtcgttctacgactatgccttcctgcgcgaggtgccg
cggctgcactgcgtgctggaagaccgcttgcaggatgcctccgccgacggtgcctcgaac
gagatggcgtcgttcctgcggatcggaagctggatcggcggcgaccgcgacggcaatccg
ttcgtgacggccgacgtcatgcgcggcaccctgcggatgcaggcctcgcgggtattgcgc
tattatctcgatgagttgcacgaactcggccgcgaactgtcgctggccgccgatctcacg
gatgtctcgccggaactgcgcgggctggccgaacgatcggccgatacctcgccgcatcgc
cgcggcgagccctaccgcctcgcggtgtccggcatttacgcgcggctttcagccacggcg
ctgaagctgaaggcggacacgctgcgcccgccttacggcaaggccccgccctatgcgagc
gccgccgaattcagcgcggatctcgatgttctccaccgctcgctgacccagaataactcg
gaggtgatcgcgcgcgggcggctgcgccatctgcgccgcgctgccgactgtttcggcttc
catctcgcctgcctcgacttgcggcagaactccaccgttcacgagcgcaccatcgccgaa
ctgctcgatgccgccgtgccgggcacgtcctatctggccctgagcgaggaggcgcggatc
gtcgtgctgctgcgagaactgcgcagcgcgcggccgttgacgtcgccgttcatcacatac
agcgacgagacgctaggcgaactcgcggtgttccatgccgcggcggaggcgcacgagatg
ttcggccccggcgcgatccctcaatgcatcatctcgatgagcgagggcgtatccgacctg
ctcgaggtcgcgttgctgctgaaggaagccgacctcgtcgaccccacgggtcacagcgcc
atcaacatcgtgccgttgttcgagaccatcgaggacttacaggcctgcgccggcatcatg
gaccggctgctgtcgctcccggaataccgggcgctggtggacagccgcggcggcctgcag
gaggtgatgctcggctattccgacagcaacaaggacggcggcttcgtcacgtccggatgg
gagctttacaaggccgagatcggcctcgtcgaggtgttcgagcgccaccaagtgcggctg
cggctgtttcacggccgcggcggatcggtcggacgcggcggcggaccgagctacgacgcc
attctcgcgcaacccggcggcgccgtgaacggccagatcaggatcaccgaacagggcgaa
atcatctccagcaaatactccaacgccgaggtcggccgcaacaatctggaaatcctcgct
gccgcgacgctggaggcgagtctgttgcagccgcgacagagcgcaccgagccttgactat
ctcgacgccatggagtcgctgtcgtcgcgcgccttcgcggcctaccgcaacctcgtctac
gagacgccgggcttcgaggactatttctgggcctctaccgtcatcaacgagatctcgaca
ttgaatatcggcagccggccggcatcgcgcaagaagacgcgccggatcgaggatctccgg
gcgatcccgtgggtgttcagttgggcgcaatgccgcgtgatgctgccggggtggtacgga
ttcggcagcgcggtggaatcctggatagcggatcatcccgacaagggcatggcgttcctg
caggagctgtatggcgagtggccgttcttccgcatgttgctctccaacatggatatggtg
ctggcgaaaagctcgatcgcgatcgcgtcgcgctatgccgatctggtgcccgacgtgacg
cttcgcgagaccatcttcgggcgtatccggagcgagtggcacctcaccatcgacacgctg
ctcgcgatcatggggcaggagcggctgctcgccggcaatccgctgcttgagcgttcgatc
cgcaaccgtttcccctatctcgatccgctcaatcacgtgcaggtcgaattattgaaagac
caccgtgcacagggtggcgacgagcaggtgctgcgcggtatccagctcaccatcaacgga
atttccgcgggcctgcgcaacagcggctga

DBGET integrated database retrieval system