KEGG   Nitrobacter hamburgensis: Nham_3750Help
Entry
Nham_3750         CDS       T00348                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00630  Glyoxylate and dicarboxylate metabolism
nha00710  Carbon fixation in photosynthetic organisms
nha01100  Metabolic pathways
nha01120  Microbial metabolism in diverse environments
nha01200  Carbon metabolism
Module
nha_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nha_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nham_3750
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nham_3750
Enzymes [BR:nha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nham_3750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABE64474
UniProt: Q1QGD3
LinkDB All DBs
Position
complement(4130679..4131104)
Genome map
AA seq 141 aa AA seqDB search
MRITQGCFSFLPDLTDEQISKQIQYCLTQGWAVNIEFTDDPHPRNTYWDMWNLPMFDLKD
AAGVLMELNECRKVYGDRYIRMSAFDSSHGWESVKISFIVNRPKDEPGFRLERQESDNRN
IRYTTTSYAVTARPEGQRYSS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattactcaaggttgtttttcgttcctgcccgatctgaccgacgagcagatttcc
aagcagatccagtactgcctcacccagggctgggcggtgaacatcgagttcaccgacgat
ccgcatccccgcaacacgtattgggacatgtggaatctgccgatgttcgacctgaaggac
gcggcaggcgtgctgatggaactgaacgagtgccggaaggtctatggcgaccgctacatc
cggatgtctgcattcgattccagccatggctgggagtcggtgaagatttcgttcatcgtc
aacaggcccaaggatgagccgggcttccggctcgagcgccaggagtccgacaaccgcaac
atccggtacaccacgacgtcgtatgcggtgaccgcacgtcccgagggtcagcgttactcc
tcgtga

DBGET integrated database retrieval system