KEGG   Nitrobacter hamburgensis: Nham_4049Help
Entry
Nham_4049         CDS       T00348                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nha  Nitrobacter hamburgensis
Pathway
nha00630  Glyoxylate and dicarboxylate metabolism
nha00710  Carbon fixation in photosynthetic organisms
nha01100  Metabolic pathways
nha01120  Microbial metabolism in diverse environments
nha01200  Carbon metabolism
Module
nha_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nha_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nham_4049
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nham_4049
Enzymes [BR:nha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nham_4049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABE64713
UniProt: Q1QGD4
LinkDB All DBs
Position
p1:7266..8732
Genome map
AA seq 488 aa AA seqDB search
MNVLNEKSLTVRGKDRYKSGVMSYKKMGYWEPDYTPKDTDIICLFRVTPQDGVDPIEAAA
AVAGESSTATWTVVWTDRLTAAEKYRAKCYRVDPVPGAEGQYFAYIAYDLDLFEPGSISN
LTASVIGNVFGFKPLKALRLEDMRLPVAYVKTFKGPPTGIVVERERLDKFGRPLLGATVK
PKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYCMEAVNRAQAATGEI
KGSYLNVTAATMEDMYERAEFAKELGSVVVMIDLVIGYTAIQSMSNWARKNDMILHLHRA
GHSTYTRQRNHGVSFRVISKWMRLAGVDHIHAGTVVGKLEGDPLTTRGYYDICREEHNPM
QLEHGIFFDQNWASLNKMMPVASGGIHAGQMHQLIQHLGEDVVLQFGGGTIGHPMGIQAG
ATANRVALEAMILARNEGRDYVSEGPDILAKAAASCTPLKQALEVWKDVTFNYQSTDAPD
YVTTPAVA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtccttaacgagaagtcgctgacggttcgcggcaaggaccgttataaatccggt
gtcatgtcctacaagaagatgggctattgggagcccgactatacgccgaaggacacggac
atcatttgtctgtttcgggttacgccgcaggacggcgtcgacccgatcgaagcggctgcg
gcggtggccggcgaatcctcgaccgcgacctggaccgtggtgtggacggaccgtctcacg
gcggcggagaaatatcgcgccaagtgctaccgcgtcgatccggtaccgggggcggaaggc
cagtacttcgcctatatcgcctacgatctcgacctgttcgaacccggttcgatctccaac
ctcaccgcgtcggtcatcggtaacgtgttcggcttcaagccactcaaggccttgcgcctc
gaggacatgcggttgccggttgcctacgtcaagacgttcaaagggccgcccaccggcatc
gtcgtcgagcgcgagcgtctcgacaagttcggccggccgctgctcggcgccaccgtcaag
ccgaagctcggcctgtccggccgtaattacggccgcgtggtctatgaggcgctgaagggc
ggtctcgacttcaccaaggacgacgagaacatcaactcgcagccgttcatgcactggcgt
gaacgtttcctctactgcatggaagcggtcaaccgcgcccaggcagcgaccggcgagatc
aagggcagctacctcaacgtcaccgcggcgacgatggaggacatgtacgagcgtgccgag
ttcgccaaggagctagggtcggtggtcgtcatgatcgatctggtgatcggctacaccgcg
atccagtcgatgtcgaactgggcgcgcaaaaacgacatgatcctgcatctgcatcgcgcc
ggtcattcgacctacacgcggcagcgcaatcacggcgtgtcgttccgcgtcatctccaaa
tggatgcggctcgccggtgtcgatcacatccacgccggaaccgtggtcggcaagctggaa
ggcgatccgctgaccacgcgcggctactacgatatctgccgcgaagagcacaatccgatg
caactcgagcatggcatcttcttcgaccagaactgggccagcctcaacaagatgatgccg
gttgcttccggcggcattcatgccggccagatgcaccagctcatccagcatctcggtgaa
gacgtggtgttgcagttcggcggcggcaccatcggtcacccgatgggcatccaggccggc
gcgaccgccaatcgcgtggcgctggaggcgatgatcctcgcccgcaacgagggccgcgat
tacgtcagcgaaggtccggatatcctggccaaggcagccgcaagctgcacgccgttgaag
caggcgctcgaagtgtggaaggacgtcaccttcaactaccaatccaccgacgcgcccgat
tatgtaacgaccccggccgtagcgtaa

DBGET integrated database retrieval system