KEGG   Nectria haematococca: NECHADRAFT_100651Help
Entry
NECHADRAFT_100651 CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nhe  Nectria haematococca
Pathway
nhe00020  Citrate cycle (TCA cycle)
nhe00480  Glutathione metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
nhe01200  Carbon metabolism
nhe01210  2-Oxocarboxylic acid metabolism
nhe01230  Biosynthesis of amino acids
nhe04146  Peroxisome
Module
nhe_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NECHADRAFT_100651
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NECHADRAFT_100651
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NECHADRAFT_100651
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NECHADRAFT_100651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 9666174
NCBI-ProteinID: XP_003051313
JGI: 100651
UniProt: C7YSA6
LinkDB All DBs
Position
5
AA seq 466 aa AA seqDB search
MPAVAFASAVPRSLLSSSLRRVAFASSSPIAVRPIRASFGAVQTISPFAVRTMASAIPKI
KVKNPVVELDGDEMTRIIWQSIKDKFIYPYLDIDLKYYDLGLEYRDETNDQVTIDAAEAI
KKYQVGVKCATITPDEARVEEFKLKQMWLSPNGTIRNALGGTVFREPIVIPRIPRLVPGW
KKPIIIGRHAFGDQYRAKDAVLPGPGKLSMVYTPEGGEPQEIEVYQFKNGGGVAQTQYNT
DESITGFAHASFKLALDKGLPLYMSTKNTILKKYDGRFKDIFQELYDTQYKPEFEAKKIW
YEHRLIDDMVAQMVKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFES
EAAHGTVTRHYREHQKGNETSTNPIASIFAWTRGLIQRGKLDDQPEVVSFAESLEQACID
TVDIDGVMTKDLALACGKTGREDYVTTTEYLNAVERRMKNILKEKL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgttgccttcgcctccgccgtcccgaggtctcttctatcgtcttcgctgcgc
cgtgtcgcctttgcttcttcctctccgatcgccgttcgtcctatccgcgcttccttcggt
gccgtccagaccatctctcccttcgccgtccgcacaatggcttccgctatccccaagatc
aaggtcaagaaccccgtcgtcgagctcgatggcgatgagatgacccgcatcatctggcag
tccatcaaggacaagttcatctacccctacctcgacatcgacctcaagtactatgacctt
ggtcttgagtaccgtgacgagaccaacgaccaggtcaccattgatgccgccgaggccatc
aagaagtaccaggtcggtgtcaagtgcgccaccatcacccccgatgaggcccgagtcgag
gagttcaagctgaagcagatgtggctttcccccaacggaactatccgaaatgccctcggc
ggtaccgtcttccgtgagcccattgtcatcccccgcattccccgtcttgtccctggctgg
aagaagcccatcatcattggccgacacgccttcggagaccagtaccgcgccaaggatgct
gtcctgcccggccctggcaagctctccatggtttacacccccgagggtggtgagccccag
gagattgaggtctaccagttcaagaacggtggtggtgtcgcccagacccagtacaacacc
gacgagtccatcactggcttcgcccacgcctctttcaagctggctcttgacaagggtctt
cccctctacatgagcaccaagaacaccatcctcaagaagtacgatggtcgcttcaaggat
atcttccaggagctctacgacacccagtacaagcccgagttcgaggccaagaagatctgg
tatgagcaccgtctcattgacgacatggtcgcccagatggtcaagagctctggtggttac
atcatggccctcaagaactacgacggtgatgtccagtccgacattgtcgctcagggcttc
ggctcccttggtctcatgacctcggtcctcatcacccccgatggcaagaccttcgagtct
gaggctgcccatggcaccgtcactcgccactaccgtgagcaccagaagggcaacgagacc
tccaccaaccccattgcctccatcttcgcctggacccgtggtctcatccagcgtggcaag
ctcgacgaccagcccgaggttgtctccttcgccgagagcctcgagcaggcctgcattgac
actgtcgatattgatggtgtcatgaccaaggatcttgcccttgcctgcggcaagaccggc
cgtgaggactatgtcaccaccaccgagtacctcaacgctgttgagcgccgcatgaagaac
atcctcaaggagaagctgtaa

DBGET integrated database retrieval system