KEGG   Nectria haematococca: NECHADRAFT_102963Help
Entry
NECHADRAFT_102963 CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nhe  Nectria haematococca
Pathway
nhe00250  Alanine, aspartate and glutamate metabolism
nhe00410  beta-Alanine metabolism
nhe00430  Taurine and hypotaurine metabolism
nhe00650  Butanoate metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
Module
nhe_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NECHADRAFT_102963
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NECHADRAFT_102963
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NECHADRAFT_102963
   00430 Taurine and hypotaurine metabolism
    NECHADRAFT_102963
Enzymes [BR:nhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NECHADRAFT_102963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 9677199
NCBI-ProteinID: XP_003049828
JGI: 102963
UniProt: C7YW59
LinkDB All DBs
Position
1
AA seq 567 aa AA seqDB search
MSLVENTEPNEVPSPATNGHSNGYFSNGHHPTSNGNGAVTPSYIDSMAHLSVVRARDDSD
AASVKSTSSRASRRPPLQLASYQDEFTTSVYGSRFAGMDLPRHHMPECEMPRDIAYRMIK
DDLSLDNNPMLNLASFVTTYMEDEAEKLMSESFSKNFIDYEEYPQSADIQNRCVNMIGDL
FHAPPGTSVGTSTVGSSEAIMLGVLAMKKRWKNRRIAEGKSTEHPNIVMSSAVQVCWEKA
TRYFEIEEKLVYCTPERFVMDPDEAVDLCDENTIGMCCILGTTYTGEYEDIKAINDLLVE
RNMDVPIHVDAASGGFVAPFVVPDLEWDFRCEKVISINVSGHKYGLVYPGVGWVIWRSPE
YLPQELVFNINYLGADQSSFTLNFSKGASQVIGQYYQLIRLGKHGYRAIMSNLTRTADYL
TETLENLGFVIMSERSGAGLPLVAFRFRTTEEGGDPDRYYDEFALAHHLRSRGWVVPAYT
MAPNSGVKMLRVVVREDFTKTRCDSLIADIKLCHGLLKETDQESIRKREEYIKNHVSSMG
RGKHGHPVYSNEQHSLQGKTGKTHAIC
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgtcgaaaatacggaacctaacgaggttccttcacccgccacaaacggccac
tccaacggctacttctccaacggtcaccacccaacgtccaacggcaacggtgctgtcact
ccctcctacatcgacagcatggctcacctctcggtcgtccgcgcccgagacgactcggac
gccgcctcggtgaaatccacgagctcccgcgcttcccggagacctcccctgcagcttgca
agctaccaggacgagttcaccaccagcgtctatggatcccgctttgcgggcatggacctg
ccccggcatcatatgccagagtgcgagatgccccgcgatatcgcgtatcgcatgatcaag
gacgatctgagcctcgacaacaaccccatgctcaacctcgcttctttcgtcaccacttac
atggaagatgaagctgaaaaactcatgtcagagtccttctccaagaactttatcgactat
gaggagtaccctcagtcagccgatattcagaaccgatgtgtcaacatgattggtgacctc
ttccacgctcccccaggtacatctgtcggcacatctacagtcggttcttcagaagccatc
atgctgggcgtcttggccatgaagaagcgctggaagaaccgcagaatcgccgagggcaag
agcaccgagcatcccaacattgtcatgtcttctgccgtccaggtctgctgggaaaaggcc
actcgatactttgagattgaggagaaacttgtctactgcacgcctgagcgcttcgtcatg
gaccctgatgaggctgttgatctgtgtgatgaaaacactatcggcatgtgctgtatcctc
ggtaccacttacactggtgagtacgaggatatcaaggccatcaatgacctcctcgttgag
cggaacatggacgtccctatccacgtcgatgctgctagcggtggcttcgtcgcccccttt
gtcgtccccgatcttgagtgggacttccgatgtgaaaaggtcatttccatcaacgtctct
ggccacaagtacggtctcgtctaccccggtgtcggttgggtcatctggcgatctcctgag
tatctccctcaagaactcgtcttcaacatcaactaccttggtgccgaccaatcctcattt
accctcaacttctccaagggtgcttcacaggtcattggccagtactaccagctcatccgt
ctgggtaagcacggttaccgcgccatcatgagcaatctgacccgaactgccgactacctg
accgagacgctcgagaacctcggcttcgtcatcatgtcagaacgttcaggtgctggcctt
cctctcgtggcgttccgcttccgaaccacagaggagggcggcgatcccgaccgttactac
gacgagttcgctctcgctcaccacctccgctcccgaggatgggtcgtgcccgcctacacc
atggctcccaactcgggtgtcaagatgctccgtgtcgttgtccgtgaggatttcacaaag
acccgttgcgactctctcatcgccgatatcaagctctgccacggtcttctcaaggagaca
gaccaagagtccatccgcaagagggaagagtacatcaagaaccacgtcagctccatgggc
cgggggaagcacggccaccctgtctactcgaacgagcaacattcgcttcagggaaagact
ggcaagacccatgctatttgctag

DBGET integrated database retrieval system