KEGG   Nectria haematococca: NECHADRAFT_105821Help
Entry
NECHADRAFT_105821 CDS       T01612                                 

Gene name
hxk1
Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nhe  Nectria haematococca
Pathway
nhe00010  Glycolysis / Gluconeogenesis
nhe00051  Fructose and mannose metabolism
nhe00052  Galactose metabolism
nhe00500  Starch and sucrose metabolism
nhe00520  Amino sugar and nucleotide sugar metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
nhe01200  Carbon metabolism
Module
nhe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nhe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NECHADRAFT_105821 (hxk1)
   00051 Fructose and mannose metabolism
    NECHADRAFT_105821 (hxk1)
   00052 Galactose metabolism
    NECHADRAFT_105821 (hxk1)
   00500 Starch and sucrose metabolism
    NECHADRAFT_105821 (hxk1)
   00520 Amino sugar and nucleotide sugar metabolism
    NECHADRAFT_105821 (hxk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NECHADRAFT_105821 (hxk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nhe04131]
    NECHADRAFT_105821 (hxk1)
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     NECHADRAFT_105821 (hxk1)
Membrane trafficking [BR:nhe04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    NECHADRAFT_105821 (hxk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 9674468
NCBI-ProteinID: XP_003054311
JGI: 105821
UniProt: C7YHA2
LinkDB All DBs
Position
1
AA seq 492 aa AA seqDB search
MVGLGPRRPPSRKGSMADVPKDLADEIHKLEKLLTVDAAKLKEITNHFVSELAKGLSVEG
GSIPMNPTWVMSFPDGYETGTYLALDMGGTNLRVCQITLTEEKSEFDIIQSKYRMPEELK
SATSEELWDYIADCLFQFLETHHGDCTNMEKLPLGFTFSYPATQNYIDEGILQRWTKGFD
IEGVEGENVVPMFEEALTRRGVPIKLAALINDTTGTLVASAYTDVDMKIGCIFGTGCNAA
YFENCGSIPKLAHLNLPPDLPMAINCEWGAFDNEHKVLPRTPYDVIIDKESPRPGQQAFE
KMIAGLYLGEIFRLIMVDLHDNKNVHIFENQDIALLRKPYSLDASFLSFIEEDPFENLQE
TYDLFSSKLNLACTRPELELIRKTAELIGTRAARLSACGVAAVCKKKNYETCHVGADGSV
FNKYPYFKERGAQALREILDWPKKTNKRAEDPVEVLAAEDGSGVGAALIAALTLKRINEG
NLAGILHPENFK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcctcggacctcgtcgtcctccctcccgaaagggatctatggccgatgtcccc
aaggacttggctgatgagattcacaagctggagaagctcttgactgtcgacgctgccaag
ctcaaggagatcaccaaccactttgtttctgagctcgccaagggtcttagtgtcgagggt
ggcagtatccctatgaaccctacctgggttatgtctttccccgatggctacgagaccggt
acctatctggccctggacatgggtggcaccaacctgcgagtgtgtcagatcacactcact
gaggagaagtcggaattcgacatcattcagtccaagtatcgcatgcccgaggagctcaag
tctgctacctcggaggagctatgggactacatcgccgactgtctcttccagttcctcgaa
acgcaccatggcgactgcaccaacatggagaagcttcccctgggtttcaccttctcctac
cccgctactcagaactacatcgacgagggtattcttcagcgatggaccaagggcttcgac
attgaaggtgtcgagggcgagaacgttgttcccatgtttgaggaggctttgacccgacga
ggtgtgcccatcaagctggcagctttgatcaatgatactactggtacattggttgcttcg
gcctacaccgatgtggacatgaagattggttgcatcttcggcactggctgcaacgcagct
tactttgaaaactgcggctccattcccaagcttgctcacctgaacctccctcctgacctg
cccatggccatcaattgcgagtggggagcttttgacaacgagcacaaggttctccctcga
actccctacgatgtcattatcgacaaggagtctcctcgccctggccagcaggccttcgag
aagatgattgccggcctctacctgggcgaaattttccgacttatcatggtcgaccttcac
gacaacaagaatgtgcacatctttgagaaccaggacattgccttgctccgcaagccctac
agcctggatgcctccttcttgtccttcatcgaggaggatccctttgagaacttgcaggag
acatacgacctcttctcatccaagctcaatctggcttgcacacgccctgagctggagctt
atccgcaagaccgccgagcttatcggcactcgagctgctcgcctctcggcttgcggtgtt
gctgctgtctgcaagaagaagaactacgagacctgccacgtcggtgctgatggctcagtc
ttcaacaagtacccctacttcaaggagcgaggagcccaggctctgcgggagattctcgac
tggcccaagaagacgaacaagagggccgaggaccccgtcgaggtccttgccgccgaagat
ggtagcggtgtcggcgctgccctgatcgccgccctgaccctcaagcgtatcaacgagggc
aacctagcgggtatcctccaccctgagaacttcaaatga

DBGET integrated database retrieval system