KEGG   Nectria haematococca: NECHADRAFT_40795Help
Entry
NECHADRAFT_40795  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
nhe  Nectria haematococca
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nhe01002]
    NECHADRAFT_40795
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nhe04147]
    NECHADRAFT_40795
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     NECHADRAFT_40795
Peptidases [BR:nhe01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   NECHADRAFT_40795
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NECHADRAFT_40795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 9668328
NCBI-ProteinID: XP_003051405
JGI: 40795
UniProt: C7YSR9
LinkDB All DBs
Position
5
AA seq 250 aa AA seqDB search
MVKFAAILALVAPLVAARPQDRPMIVGGTAASAGDFPFIVSISYNGGPWCGGTLLNANTV
MTAAHCTSGRAASAFQVRAGSLNRNSGGVTSAVSSIRIHPSFSGSTLNNDVSILKLSTPI
STSSTISYGRLAASGSDPAAGSDATVAGWGATSEGSSSSPVALRKVTIPIVSRTTCRSQY
GTSAITTNMFCAGLAEGGKDSCQGDSGGPIVDTSNTVIGIVSWGEGCAQPNFSGVYARVG
SLRSYIDGQL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagtttgctgccatcctcgcacttgttgcgcctcttgtcgccgctcgtcctcag
gaccgacccatgatcgtcggcggaactgctgccagcgctggtgacttccccttcatcgtc
agcatctcctacaatggcggcccctggtgcggaggtaccctcctcaacgccaacaccgtc
atgactgctgcccactgcacttctggtcgcgctgccagcgccttccaggtccgcgctgga
agtctgaaccgcaactcgggtggtgttacctctgccgtttcttccatcaggatccatcct
agctttagtggctcgaccctgaacaacgatgtttccatcctgaagctgtccactcccatc
tcgactagctccaccatctcttatggtcgcctggctgcgtcgggctccgaccctgctgcc
ggctctgatgccacagttgcaggctggggtgccacttctgagggctcttccagctcccct
gtcgctttgaggaaggttaccattcccattgtctctcgcaccacttgccgatcccagtat
ggcacctctgccattaccaccaacatgttctgcgctggccttgctgagggtggaaaggac
tcatgccagggcgacagcggcggtcccatcgtcgacacctccaacactgtcattggtatt
gtttcttggggtgagggttgtgctcagcccaacttctctggtgtctatgcccgcgttggc
agcctccgctcttacattgacggccagctgtaa

DBGET integrated database retrieval system