KEGG   Nectria haematococca: NECHADRAFT_43145Help
Entry
NECHADRAFT_43145  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nhe  Nectria haematococca
Pathway
nhe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NECHADRAFT_43145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nhe02000]
    NECHADRAFT_43145
Enzymes [BR:nhe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NECHADRAFT_43145
Transporters [BR:nhe02000]
 Other Transporters
  Pores ion channels [TC:1]
   NECHADRAFT_43145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C GST_C_3 GST_C_5 Cep57_MT_bd
Motif
Other DBs
NCBI-GeneID: 9673080
NCBI-ProteinID: XP_003045069
JGI: 43145
UniProt: C7Z943
LinkDB All DBs
Position
6
AA seq 280 aa AA seqDB search
MTNVDTSLPAEPSGAAAEFAARHSEEHPLKLYGGWFCPFVQRSWITLHEKNVPHQYIEIN
PYKKEASFLAMNPRGLVPTLAVPVGTKGEVQKPLFESNIVCEYLDEAYADEATYGPRLLP
SDPYERARCRLWIDHISSRIIPAFYKLLQHTPEKPYSLDQAREELHGHIKTLVKEMDAKG
PWFLGDNLSLVDICLAPWVKRLFLIDHYKNGGHGIPQSGGGDDEGTWARWRKWSDAILDR
KSVKETWSADERYIIAYKRYADDTTNSLVGQATREGKRLP
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgttgatacctcgctccccgctgagccctcgggggctgcggccgagttcgct
gcccgtcactcagaagagcacccgctgaagctctacggcggctggttctgcccttttgtg
cagcgatcatggatcaccctgcacgagaaaaacgtaccgcatcaatacatcgagatcaac
ccgtacaagaaggaggcatccttcctcgcaatgaaccctcgtggtcttgtaccaactctg
gctgtacccgtcggcaccaaaggcgaggtgcagaagcccttgtttgagagcaacatcgtt
tgcgagtacctggacgaggcttatgcagatgaggccacctacggtccgcggctgctcccc
tctgatccttatgagagggcacgatgcagactctggatcgatcacatcagctcacgaatc
atccctgctttctacaagctgctccagcacactcctgaaaagccctacagtctggatcaa
gcacgagaggagctccatggccacattaaaaccttagtcaaggaaatggatgccaaagga
ccctggttcttgggcgacaacttgagtctcgtggatatttgcctggcgccttgggttaaa
cgcctgttcctgatcgatcactacaagaatggcggacacggaattcctcagtctggtggt
ggagatgatgagggtacctgggcgagatggagaaagtggagcgatgccatccttgatcgc
aagagcgtcaaggaaacatggagcgctgacgagcggtacatcattgcttacaagagatat
gctgatgatactaccaattctcttgtaggtcaggccacaagagaaggaaagaggctgcct
taa

DBGET integrated database retrieval system