KEGG   Nectria haematococca: NECHADRAFT_43928Help
Entry
NECHADRAFT_43928  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
nhe  Nectria haematococca
Pathway
nhe03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    NECHADRAFT_43928
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nhe03400]
    NECHADRAFT_43928
Enzymes [BR:nhe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NECHADRAFT_43928
DNA repair and recombination proteins [BR:nhe03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     NECHADRAFT_43928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 RNA_ligase DNA_ligase_A_C BRCT LIG3_BRCT mRNA_cap_enzyme DNA_ligase_IV
Motif
Other DBs
NCBI-GeneID: 9673470
NCBI-ProteinID: XP_003044829
JGI: 43928
UniProt: C7Z9K8
LinkDB All DBs
Position
6
AA seq 991 aa AA seqDB search
MGSQQEQRPQTEDAKHEDEIQYGTVGITQEEMEEKYPNRPKNHSKTLVFSELFRELFNPL
SENKKQNATGAGPRKAFRGVNKLSPHEQRRHIIERFIIRWRKEVGPDFYPALRLILPDKD
RDRGVYGLKENAIGKLLVKLMKIDKSSEDGYNLLHWKLPGQTTASRLAGDFAGRCFEVIS
KRPMRTTVGTMTIAEVNEQLDKLAASTGETENLRIFETFYNHMNAEELMWLIRIVLKQMK
VGATEKTFLDLWHPDGDALFSVSSSLRRVCWELSDPEIRLEQDEAGVALLQCFQPQLAQF
QMPASFQKMIQLLRPTEEDPEFWIEEKLDGERMQMHMVEDKKHPGGRRFCFWSRKAKDYT
YLYGDGLQDENSSLTRHLKKAFASGVKNLILDGEMITWDMGVDKIVPFGTLKTAALAEQQ
NKSDTNSAGHRPLFRVFDILYLNNKPLTQYTLRDRHRALEKAVKSVHRRLEIHNYTSATT
SDAIEPLLREVVANASEGLVLKNPRSMYRLNHRNDDWLKVKPEYMSEFGESLDCVIIGGY
YGSGKRGGMLSSYLCGLRVTQNHIQAGANPEKCFSFFKVGGGFRAEDYAEIRHRTEGKWI
EWDQKNPPSEYIELGGGELRQYERPDMWIRPKDSVVVSVKAASVGPSDQFARGFTLRFPR
FRRLRLDRTWDTALSLEEFQELKDRVDEESKEKAMTVEDRKRRNPKRIKRELVIAGEDSA
PVEFEGEKTKLFEGLEFCVLSEALKPYKKTKTQLESIIKENGGTISQRAAPGTNMVLIAD
KKVVKVASLMKGGDVDLIRPKWIKDCLEQDLGQFLLPFEESHLFHATEAMKRAAEQNTDQ
FGDSYARDMSIDELKDLMDCMPKIEDGEPFNKNEFLQQLEDHGKDLGNLRSFIFRRCVVL
FHGVDTGINRVSRLKHFVKYGGGSVTEDAGDLSVTHVVIEGGDPMQMGEAADMVRKELSS
RRTQPRVVAGKWIEDCWKEGTLLDEEQFVVP
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtcaacaggaacaaagaccccagaccgaagatgcgaaacatgaagatgagatt
cagtacggcacagtaggaattacccaggaggaaatggaggaaaaatatccgaaccgccca
aagaatcactcaaagaccctagtcttctctgagctgtttcgagagttgtttaatccatta
agcgaaaacaagaagcaaaatgccaccggcgcaggccctagaaaggcattcagaggtgtc
aataagctctcaccccacgagcagcgacgacacattatcgagcgcttcatcattcgatgg
cgcaaagaagtcggtcccgatttctaccctgccctgcgtctaattctccccgacaaggat
cgcgatcgaggtgtttacggcctcaaggagaatgcaataggaaagctcctggtcaagttg
atgaagatcgacaagagctccgaggatggctacaatcttttgcactggaagttacctggt
caaaccactgcctctcgcctggctggcgactttgctggacgatgcttcgaggtcatttcg
aagcgcccgatgcgcacaactgtcggtaccatgacaatcgctgaggtcaacgagcagctg
gataagcttgctgcgtctacaggagagacagagaatctgcgtatctttgagactttctat
aaccacatgaatgccgaagagttgatgtggcttattaggatcgtcttgaagcagatgaag
gtcggcgccacggaaaagacctttttggatctctggcacccggacggcgacgccctcttc
agcgtgtcttcgagcttgagacgagtatgttgggaactttccgaccccgagattcggctc
gagcaggatgaggcgggcgttgccctcttgcaatgcttccaaccgcaacttgcccaattc
cagatgcctgcgtcttttcagaaaatgattcagcttctccgaccgacagaggaggaccct
gaattctggatcgaggagaagctggatggcgagcgtatgcaaatgcacatggtcgaggac
aaaaagcaccctggcggccgaaggttttgcttctggtcaagaaaggccaaggactacaca
tacctctacggcgacggacttcaagacgagaactcgagtttaacacggcatctcaagaag
gcctttgcatcaggtgtcaagaatctgattctggacggcgagatgattacctgggatatg
ggcgttgacaagatagtccctttcggcactctcaagacggccgctctcgcagagcagcag
aacaagtcggatacaaactcggctggtcaccgtcccctattcagggtctttgatatcctc
tacctcaacaataagcccttaactcagtataccctccgagatcgacaccgcgctctagaa
aaggccgtcaaatctgttcatcgacgtcttgaaattcacaactacaccagcgcaacaact
tctgatgctattgaaccacttctccgcgaagttgttgccaacgcgtcagaaggtctcgta
ctcaagaatcctcgttcaatgtaccgcctcaatcaccgaaacgacgattggctcaaggtc
aaacctgaatacatgtccgagttcggcgagtccctcgactgtgtcattatcggtggctac
tacggctcagggaagcgcggcggaatgctttcgagttatctgtgtggtctacgagtgaca
cagaaccacatccaagcgggcgcaaatcctgaaaagtgcttcagttttttcaaggtcgga
ggtggattccgtgccgaagactatgcagaaatccgacaccgaacagaaggaaagtggatt
gagtgggatcaaaagaacccgccctcagaatacatcgagcttggaggaggtgagctcaga
cagtatgaacggccagacatgtggattcgtcctaaagactcggtcgttgtttcagtgaaa
gcagcgagcgttggtccttcagaccagtttgctcgtggattcactttgcgcttcccacga
ttcaggcgtctccgtttggatcggacatgggacactgccctatccctagaggagtttcag
gagctgaaagatcgggttgatgaagagtcaaaagagaaggccatgacggttgaagacaga
aagagacggaatcccaaacgaatcaagagggagcttgttatagctggagaagattcagcg
ccggtcgagtttgagggcgagaagacgaagctttttgaagggttggagttttgcgtcctt
tctgaagctctgaagccctacaaaaagactaaaacccaactcgagtccattatcaaagaa
aacggaggtaccatttctcaaagagcggcaccaggtacaaacatggtgcttattgccgac
aagaaggtggtcaaagtggcgagtctcatgaaaggaggagacgtggaccttatccgtccc
aaatggatcaaagattgcctggagcaggatctgggacaatttctgctgccgtttgaggaa
tcacacttgtttcacgctacagaagcgatgaagcgcgcggcggagcagaacacggatcag
tttggagacagctacgctcgagacatgtccattgatgaactcaaggatctcatggactgt
atgcccaagatcgaggacggggagccattcaacaagaatgagtttctacagcagcttgaa
gatcacggcaaagatctgggcaacttgaggagctttattttccggcgctgcgtggtgttg
ttccatggggtggacaccggtatcaatcgggtctctcggttgaagcactttgtcaagtat
ggtggaggaagtgtcactgaggacgcaggcgacttatctgtgacacatgttgtgatagaa
ggaggagatccaatgcaaatgggtgaggcggccgatatggtgcgtaaggagctgagctca
agacgcacacaacccagggtggtggctggaaaatggatcgaggattgctggaaggagggc
acattgcttgatgaggagcagtttgtggttccatga

DBGET integrated database retrieval system