KEGG   Nectria haematococca: NECHADRAFT_70633Help
Entry
NECHADRAFT_70633  CDS       T01612                                 

Definition
(RefSeq) glycoside hydrolase family 31
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
nhe  Nectria haematococca
Pathway
nhe00052  Galactose metabolism
nhe00500  Starch and sucrose metabolism
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NECHADRAFT_70633
   00500 Starch and sucrose metabolism
    NECHADRAFT_70633
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     NECHADRAFT_70633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 9679184
NCBI-ProteinID: XP_003040783
JGI: 70633
UniProt: C7ZLQ2
LinkDB All DBs
Position
7
AA seq 954 aa AA seqDB search
MHLKNLFVSATAFAGACFAQSKAGVEDLDKAGNDLFEKDLSKCPGYKAVKHWQTKDGFYA
DLALAGPACNVFGTDLPKLKLEVEYQTSERLHVKILDTNNTVYQVPDSVFPRPGYGQWCS
PKNSKLKFAFKADPFSFTVSRSDTGEVLFDTSGNKLVFENQYVYLKTNLPPSPHLYGLGE
HSDSFMLNTTNYTRTIYTRDSYGVPQGENLYGAHPIYFDHRDKGTHGVFLLNSNGMDIFI
DKKAGKQFLEYNIIGGVLDFYFIAGPSPKEVARQYAEITQLPLMTPYWGLGFHQCRYGYR
DVYEVAAVVANYSSQNIPLETMWTDIDYMDRRRIFTIDPERFPAHLYKDLVDTIHARDQH
YIVMVDPAVYYKESNPALDAGLEYDTFIKEPNGSDYKGVVWAGPSYFPDWFHPDSQKYWT
EQFAEFFDGTNGPDIDALWIDMNEPANFYNRPYPGNNTTPEKFAEVDGDPPKPPPVRDGP
DAPIPGFPDSLQPNFASGNKREVASVEHTSLRPRSNRNHGAGNWRSSSHQWGQNRPGRPG
SNWQHGKRTGSGCGPDECKGLPNRELIRPPYMIQNGAGPTLADSTTDTDLVQSGGYVQYD
THNLYGAMMSTHSHNAMRARRPDKRALVITRSTFAGSGKDVSHWLGDNISGWLWYRHSIS
QILQFASLYQVPVVGPDVCGFGGNVTETLCARWAALGSFYTFFRNHNEISANSQEFYRWP
KVAEAARKGIAIRYQLLDYIYTAIYKQNQTGTPTLNPLFFNYPNDRNTYPIDLQFFYGDG
ILVSPVTEENSTSVNFYLPDDIFYEWGTGKPVRGRGEYVDAEVDVTDITIHYKGGIIYPQ
RVESANTTTALRKKGFNIVIAPGLDGSAKGSLYLDDGESLIQDAVSEIDFKYAKGKFSMT
GSFGYDVGVNIETITILGVNRKPYGGDAEYDSKNKKLVLHVDVPLTGKYEKKIL
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcaagaaccttttcgtctcagcaacggcctttgccggtgcctgctttgctcag
agcaaggcaggtgtcgaagacctcgacaaggccggcaacgatctttttgaaaaggacctc
tccaagtgtcccggatacaaggctgtcaagcattggcagacaaaggatggcttctatgcc
gaccttgctctcgctggaccggcttgcaacgtcttcgggactgaccttcccaagctgaag
cttgaggtcgagtaccaaaccagcgagcgtctacatgtcaagatcttggacaccaacaac
accgtgtaccaagttccagacagcgtgttcccgcgtcctggttatgggcagtggtgttct
cccaagaactccaagctcaagttcgccttcaaggccgatcctttctcgttcacggtatcc
cggtccgacactggtgaagttctttttgacaccagcggcaacaagttggtctttgagaac
caatatgtctacctcaagacgaatcttcccccgagtccccatctgtacggtttgggcgag
cacagcgattcgttcatgctgaacacaaccaactacaccaggaccatctacaccagagat
tcctatggagttccccaaggcgagaacctttacggtgcccacccgatctactttgatcac
agagacaagggcacccatggcgtcttcttgctcaactccaacggcatggatatctttatc
gacaagaaagccggcaagcaattccttgagtacaacatcatcggcggtgttctcgacttt
tacttcattgccggtccttctccaaaggaagtagcgaggcagtacgcagagatcactcaa
ctcccgctcatgacaccgtactggggactcggattccaccaatgtcgatacggctacagg
gatgtttacgaagttgctgccgtcgttgccaactattcttcacaaaacattcccctcgaa
acaatgtggactgatatcgactatatggaccgtcgacgcatctttaccattgacccagag
agattcccggctcatctgtacaaggatcttgtcgacacaatccacgcaagagaccagcac
tatatcgtcatggttgatcctgctgtctactacaaggagtccaaccctgcacttgatgca
ggtcttgagtacgatacctttatcaaggagcccaacggctctgactataagggtgttgtc
tgggctgggccgagttacttccccgattggttccaccctgactctcagaagtactggact
gagcagtttgccgagttctttgacggaaccaatggtccggatattgatgctctgtggatc
gacatgaacgaacctgcaaacttctataacagaccttatccaggcaacaacacgactcct
gagaagtttgccgaggttgatggcgaccctcccaagccccctcctgttcgagatggtccc
gatgcgcctatccctgggttcccggatagtcttcagcccaactttgcttctggcaacaag
agggaagttgcctctgtcgagcacaccagcctccgccctcgctccaaccgtaaccacggt
gccggcaactggcgttcttccagccaccaatggggccaaaaccgtcccggccgtccaggt
tccaattggcagcacggcaagcgcacaggttcaggctgcggccccgacgagtgcaagggt
cttcccaaccgcgagctcatcaggccaccctacatgatccagaacggtgctggacctact
cttgctgacagcacgactgatacggatcttgtccagagcggtggttacgttcagtacgat
actcacaacctttatggagccatgatgtcgacccattcgcacaatgctatgcgggctaga
cgtcctgataagcgtgctcttgtcattacacgaagcacttttgccggatctggcaaggac
gtgtcgcattggcttggagacaacatttccggctggctctggtaccgtcactccatcagc
cagatcctccagtttgcatctctctaccaggttcccgtcgttggaccagatgtctgtggc
tttggtggcaacgtcactgaaactctttgtgctcgatgggccgctcttggttccttttac
actttcttccgcaaccacaacgagatttcggccaactcgcaagagttctaccgctggccc
aaggtggcagaagcagcccgcaagggaattgccatcagataccaactcctcgactacatc
tacaccgccatctacaagcaaaatcagaccggcaccccaaccttgaaccctctcttcttc
aactaccccaacgatcgtaacacgtatcccatcgatctgcaattcttctacggtgatggc
atccttgtcagccctgttaccgaggagaacagcaccagtgtcaacttctacctcccagac
gacatcttttacgaatggggtaccggaaagcccgtccgcggacgcggcgaatatgtcgat
gccgaggttgatgtcaccgatatcaccattcactacaagggtggtattatctacccccag
cgagtagagagcgccaacaccaccaccgccctccgaaagaagggtttcaacattgtgatc
gctcccggccttgatggctctgccaagggatcactgtaccttgatgacggcgagtcactc
atccaggacgcagtttccgagattgacttcaagtatgccaagggcaagttcagcatgacc
gggtcgtttggctacgatgttggtgtgaatattgagacaatcactattcttggagtgaac
cgcaagccttatggaggtgatgcggaatatgacagcaagaataagaagctggtcttgcac
gtggatgtgcctctgacgggtaaatatgagaagaagattttgtaa

DBGET integrated database retrieval system