KEGG   Nectria haematococca: NECHADRAFT_71273Help
Entry
NECHADRAFT_71273  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nhe  Nectria haematococca
Pathway
nhe00020  Citrate cycle (TCA cycle)
nhe00310  Lysine degradation
nhe00380  Tryptophan metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
nhe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NECHADRAFT_71273
  09105 Amino acid metabolism
   00310 Lysine degradation
    NECHADRAFT_71273
   00380 Tryptophan metabolism
    NECHADRAFT_71273
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NECHADRAFT_71273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 9667730
NCBI-ProteinID: XP_003048478
JGI: 71273
UniProt: C7YZ97
LinkDB All DBs
Position
8
AA seq 1049 aa AA seqDB search
MLRNSLCRASSQLLRGARCSAASSSASISTVSARTSSWKLAASRRPLALAARRGYATSAT
SSPPDPNDNFLSGSTASYIDEMYMQWRQDPESVHVSWQIYFKNMESGEMPISQAFQPPPN
LVPNMTGGVPRLSGGLESGSDVTNHLKVQLLVRAYQARGHHTAKIDPLGIRGTNDAKGFA
NIKPKELTLEHYQFTEKDLDTEYTLGPGILPRFKRDGREKMTLREIVDACERIYCGSFGV
EFIHIPDREKCDWLRERLEVPTPFKYSVDEKRRVLDRLIWSSSFESFLATKYPNDKRFGL
EGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTTGAE
DEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDESTH
RTAMSVLLHGDAAFAAQGIVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARSTAY
CTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLNCYRKHGHNETDQPS
FTQPLMYKRITGKEPQIDIYVDKLIEEGSFTKEDIDEHKQWVWGMLEESFTKSKDYTPTS
KEWTTSAWNGFKSPKELATEVLATNETAVKPQTLEHIGEAIGSVPEGFQVHRNLKRILTN
RTKSVVEGKNIDMSTAEALAFGSLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEDTYT
PLQHLSKDQGKFVISNSSLSEFGALGFEYGYSLSSPHALVMWEAQFGDFANNAQCIIDQF
IASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPREFPTGEKLVRQHQD
CNMQIAYMTSPANLFHILRRQMHRQYRKPLVIFFSKSLLRHPLARSNIEEFTGENAGFQW
IIPDPEHETGVLKPREEIDRVILCSGQVWAALHKYRSENNIDNVAFTRIEQLNPFPWQQL
KENLDQYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNNTEHHNRKHVMYAGRNPSASVA
TGLKSVHNKEEQEFLKMAFTVKQDKLKGE
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggaattcgctctgcagagctagctctcagctcctccgcggtgctagatgctcc
gctgcctcgtcttcggcctccatctcgaccgtctcggctcgcacttcatcatggaagctt
gctgcctcccgccggcctctggccctcgctgctcgtcgcggctatgcgaccagcgccacc
tcgtcgcctcccgaccccaacgataacttcctctccgggagcaccgccagctacatcgac
gagatgtacatgcagtggagacaggacccggagagcgtccacgtctcgtggcagatctac
ttcaagaacatggagagcggcgagatgcccatctcccaggccttccagcctcctcctaac
ctggtccctaacatgaccggtggtgttccccgtctctctggcggcctcgagtctggctcc
gatgtcaccaaccatctcaaggtccagcttctcgtccgcgcctaccaggcccgtggtcac
cacaccgcaaagatcgatcccctcggcattcgaggtaccaatgacgccaagggctttgcc
aacatcaagcccaaggagctgaccctcgagcactaccaattcaccgagaaggatcttgac
accgagtacacccttggccccggtatcctgcctcgcttcaagcgcgatggtcgcgagaag
atgaccctccgtgagatcgttgatgcttgcgagagaatctactgcggctccttcggtgtc
gagttcatccacattcctgaccgtgagaagtgcgactggcttcgcgagcgtctcgaggtc
cctacccccttcaagtactcggttgacgagaagcgccgtgttctggaccgtctcatctgg
agttccagcttcgagtctttcctggccaccaagtaccccaacgacaagcgattcggtctt
gagggttgcgaaacccttgttcccggtatgaaggctctcattgaccgcagcgtcgactat
ggtgtgaaggatattgtcattggtatgccccatcgtggtcgtctcaacgttctctccaac
gtcgtccgaaaacccaacgagtccatcttcagcgagttcgctggtacgacaggtgccgag
gatgagggctctggtgatgtcaagtaccatctcggtatgaacttcgagcgacctactcct
tctggtaagcgtgtccagctctctctggtcgccaacccttcgcatctggaggccgaggac
cccgtcgtcctgggcaagacccgcgctattcagcactacaacaacgacgagtcgactcac
cgcaccgccatgagcgttctgctccacggtgatgctgcttttgctgctcagggtatcgtc
tacgagtgtctcggcttccactctctccctgccttctctaccggcggtaccatccatctc
gtcgtcaacaaccagattggtttcaccaccgaccctcgattcgcccgctctaccgcctac
tgcacggatatcgccaaggccatcgatgcccccgtcttccacgtcaacgccgatgatgtc
gaggctgtcaacttcgtctgccagcttgccgccgattggcgcgccgagttccagcacgat
gtcgtcattgacctcaactgctaccgaaagcacggccacaacgagaccgatcagccttcc
ttcacccagcctctcatgtacaagcgcatcactggcaaggagccccaaatcgacatctac
gtcgataagctgatcgaggagggttccttcaccaaggaggacattgatgagcacaagcag
tgggtttggggcatgctcgaggagagcttcaccaagtccaaggactacactcccacctcc
aaggaatggaccacctctgcttggaacggcttcaagtctcccaaggagcttgccaccgag
gtcctcgccaccaacgagaccgctgtcaagccccagactctggagcatattggtgaggct
attggaagcgttcccgagggcttccaggttcaccgcaacctgaagcgaattctcaccaac
cgaaccaagtctgttgttgagggtaagaacatcgacatgtccactgctgaggctcttgcc
tttggttctctcgtcactgagggttaccatgtccgtgtctccggtcaggatgtcgagcgt
ggtactttctctcagcgccatgctgtcttccacgaccaggagaccgaggatacctacact
cccctccagcacctgagcaaggaccagggcaagtttgtcatctccaactcgtccctgagt
gagttcggtgctcttggcttcgagtacggttactctctgtcctctccccatgccctcgtc
atgtgggaggctcagttcggtgactttgccaacaacgctcagtgcatcattgaccagttc
atcgcctccggtgaggtcaagtggatgcagcgaactggtctcgtcatgtctctgccccac
ggttatgatggccagggccctgagcactcttccggtcgtctcgagcgatacctccagctc
agcaacgaggatccccgagagttccctactggtgagaagctcgtgcgccaacaccaggac
tgcaacatgcagattgcctacatgacctctcccgccaacttgttccacattcttcgccga
cagatgcaccgacagtaccgaaagcccctcgttatcttcttctccaagtccctgctccga
caccctctggcccgcagcaacattgaggagttcactggtgagaacgctggcttccagtgg
atcatccccgaccctgagcacgagaccggcgttctcaagcctcgtgaggagattgaccga
gtcattctctgcagtggtcaggtctgggctgctctccacaagtaccgttccgagaacaac
atcgacaacgtcgccttcacccgcattgagcagctgaaccccttcccctggcaacaactc
aaggagaaccttgaccagtaccccaacgccaagaccatcgtctgggcccaggaggagcct
ctcaacgctggtgcctggagcttcactcagccccgtattgagaccctgctcaacaacact
gagcaccacaaccgcaagcacgtcatgtacgccggccgcaaccccagcgcgtcggtggcc
actggtctcaagtcggtgcacaacaaggaggagcaggagttcctcaagatggctttcact
gtgaagcaggacaagctcaagggcgagtaa

DBGET integrated database retrieval system