KEGG   Nectria haematococca: NECHADRAFT_72759Help
Entry
NECHADRAFT_72759  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
Organism
nhe  Nectria haematococca
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_3 FAD_binding_3 ADH_N_assoc ADH_zinc_N_2 NAD_binding_7 Shikimate_DH F420_oxidored Pyr_redox AlaDh_PNT_C UBA_6 DAO
Motif
Other DBs
NCBI-GeneID: 9664878
NCBI-ProteinID: XP_003042762
JGI: 72759
UniProt: C7ZFW7
LinkDB All DBs
Position
11
AA seq 368 aa AA seqDB search
MSRNLQTSFYYSTMRAARYYGKEDIRVENIPEPTVGAGQIKIAPAFVGICGTDLHEYLGG
PNFCPTTAHPVTKETIPVTLGHEFSGIISEVGPGVEGFEVGQPCAVQPTIFCGHCAACDS
HAENVCHTGGFVGLSGGGGGLSEAVCVNATHVFPLPKHLSLEIGALVEPLSVSWHAMSAA
PEINPESKVVIIGGGPIGLAMILCLKAKGVKDIIVSEVAVSRQNFAKEFGASLVVNPIKE
NLNEIVLGLSEGRGADVAFDCAGVPASVKSACEVVKTKGTVVNVAIWEKEIPFNPNWITW
KESAYKSVLGYQREDFEAVIENLGTGAIEPSQMITRKIKLENIVEDGIKALIHDKDNQVK
VLVDVNDK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaggaatctgcaaacatcattctactacagcacaatgcgcgcagctagatactac
ggaaaggaggatattcgggttgagaacattcccgaaccgacagtcggagcgggtcagatc
aagatcgccccggcctttgttggcatttgcggaacagatctccatgagtatctcggagga
cccaacttctgccccacaaccgctcatcccgtcaccaaagagaccatccccgtcacactg
ggccatgagttctcaggcatcatctcagaagtcggccctggagtagagggctttgaagtc
ggtcaaccttgcgctgttcagcctacaatcttttgtggacactgcgcagcctgtgattcg
cacgccgagaatgtgtgtcacactggcggtttcgtcggactgagcgggggtggtggtgga
ttgagcgaagctgtctgtgtaaacgctacacacgttttccctctgcccaagcatctttct
cttgagattggagctcttgtcgaacccctttctgtgtcgtggcatgctatgagcgcggca
ccagaaatcaacccagagtccaaggtggttatcatcggaggtggtcctattggcttggcg
atgatcctgtgtctcaaggccaagggtgtcaaggatattattgtctctgaggttgccgtg
tctcgccagaatttcgctaaggagtttggcgcctcgctggtggtcaaccccatcaaggaa
aacctcaacgagattgtcctgggcttgagcgagggcagaggcgctgatgtggcctttgac
tgtgccggagttcctgcaagtgtcaagagtgcatgtgaggtcgtcaagaccaagggcacc
gtggtcaacgtggccatctgggaaaaggaaatccccttcaaccccaactggatcacatgg
aaagagagtgcctacaagtctgtcctcggttaccagcgagaggatttcgaagccgttatt
gagaatctcggtacaggcgctattgagcccagccaaatgatcacccgaaaaatcaagctt
gagaacattgtggaggacggtatcaaggcgctgattcatgacaaggataaccaagtcaaa
gttttggttgatgttaatgataaatga

DBGET integrated database retrieval system