KEGG   Nectria haematococca: NECHADRAFT_92513Help
Entry
NECHADRAFT_92513  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
nhe  Nectria haematococca
Pathway
nhe00500  Starch and sucrose metabolism
nhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NECHADRAFT_92513
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     NECHADRAFT_92513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 9673156
NCBI-ProteinID: XP_003051549
JGI: 92513
UniProt: C7YPF6
LinkDB All DBs
Position
4
AA seq 582 aa AA seqDB search
MYILSSTFLLGSLALQSVLGRPADKIQVRQSGIEDFIKSESPIAIEQLLCNIGSEGCHAK
NVPAGIVIASPDTQDPDYFYTWTRDAALVFNPYTGGWGRPQRDGPALRATAMITYANWLI
SNGYTSTANDIVWPVIRNDLNYVAQYWTQTGFDLWEEVRGSSFFTTAAQYRALVEGSALA
KALGKSGDTYSNIAPQTLCFLQTYWVSNGKYVDSNINVNDGRTGKDANSILASIHNFDPS
IGCDAATFQPCSDKALANHKAVTDTFRSYNLNKGIAQGTAVAIGRYIEDVYYNGNPWYLT
TLAAAEQLYDAVYVWKQKGSITVTDTSLSFFKDLVSSVSTGTYASGSTTFQQIIDAVSTY
ADGYVGIVRKYVGPNGALAEQFSKDNGTPMSADDLTWSYAAFLSATERRAGIVPPTWQKS
SPSVPNSCGSSTVAGSYTSATQTSFPPSQTPQDGVPTPTGPTPTDGGPTSSPTSCAIATS
VDVTFEEVVKTEYGDTIKIVGSIAALGSWDTTKAISLSASEYTASNPLWKTTISLTAGQA
FEYKYINVKKDGSLVWERDPNRSYTVPKTCETKATKSDQWQG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcctgtcttctactttcctcctcggctccctcgctcttcagagcgtcttgggt
agaccggcggataagatccaagtgagacaatctggcatcgaggactttatcaagtccgag
agtccgattgccatcgagcaacttctgtgcaacattggttccgaaggttgccatgccaag
aatgttcccgctggaatcgtcattgcttcaccagacacacaagatcctgactacttttat
acctggactcgagatgctgctcttgtcttcaacccctacactggtggctggggtcgacct
caacgtgacggtcccgcccttcgagccactgccatgatcacttatgccaactggctgatc
tccaacggctacacttctacggctaatgacattgtgtggcctgttatccgcaacgatctt
aactacgttgctcagtactggactcaaactggctttgacttgtgggaagaggtcaggggc
agctcattcttcacgactgctgctcaataccgagctctcgtcgaaggtagtgcccttgcc
aaggcgctcggcaagtctggcgacacctattccaacatcgcgccccaaacactctgcttc
ttgcagacctactgggtctcgaacggtaaatatgtcgactccaacatcaacgtgaatgat
ggccgcaccggcaaggacgccaacagcatcctcgcatctatccacaactttgaccccagc
attggctgtgatgctgcaacattccaaccctgcagtgacaaggctctcgccaaccacaag
gcggtcaccgacactttccgttcctacaacctcaacaagggcatcgcacagggaactgct
gtagctatcggaagatacatcgaagatgtctactacaacggcaacccctggtatctcacc
acactcgccgcggctgagcagctgtacgatgccgtctacgtctggaagcagaagggatcc
atcactgtgactgatacatctctgtcgttcttcaaggacctggtgtcgagtgtctctact
ggtacatatgccagcggttcgaccactttccagcagattatcgatgccgtctcgacttac
gccgacggatacgttggcattgttcgaaagtacgtgggtccaaacggtgccctcgctgag
cagttctccaaggacaatggaacacccatgtctgccgacgatctgacctggtcatatgct
gctttcctctcggcaactgaacgccgagctggaattgttcctcccacttggcaaaagagt
tctccttcggttcccaacagctgtggatcaagcacagtcgctggatcatacacatcggcc
acgcagacctcgttccctccttcgcaaaccccccaggacggcgtgccaactcccaccggg
ccaacccccaccgacggaggacctacttcctcccccacaagctgcgccatcgccacatcc
gtcgacgtcacctttgaggaggtggtcaagaccgagtacggcgacaccatcaagattgtc
ggcagcatcgccgccctgggcagctgggacaccacgaaggccatctccctgagcgcctcc
gagtacacggcgtcgaaccccctgtggaagacgacgatctccctcacggctggccaggct
ttcgagtacaagtacatcaacgtcaagaaggacggctcgctggtgtgggagcgtgacccc
aaccgttcttacactgtccccaagacttgtgagactaaggctaccaagtcggatcagtgg
caaggataa

DBGET integrated database retrieval system